SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479202177|ref|YP_007830768.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479202177|ref|YP_007830768.1|
Domain Number 1 Region: 62-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000055
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479202177|ref|YP_007830768.1|
Sequence length 354
Comment ABC-type uncharacterized transport system, periplasmic component [Roseburia intestinalis M50/1]
Sequence
MKNYKKILSVVMTAAMAASLAACGNSTANTSSTTDAAASDAAQTSDAAATESGAGTSSDG
KKYTIGICQQLEHPALDQATQGFEDALTELLGSGNVTFDLQNAQGEQANCATISNGFVAN
NYDLILANATTALQCAAAATSTIPVIGTSVTDYATALDIDNWTGSTGTNVSGTADLAPID
QQEDMLVELFPDAKNVGILYCSAEPNSAYQATEFEKALDEDSISYKEYTVSDSNDIASVV
QSAVSECDVLYIPTDNTMAGNTESINNIALPAGVPIIAGEEGICSGCGAATLSISYYDIG
YTAGKMAYDVLVNGADISTMDVQYAENVTKEYNADICSQLGITVPDDYTAIAAE
Download sequence
Identical sequences D4KLH5
gi|479202177|ref|YP_007830768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]