SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479202338|ref|YP_007830929.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479202338|ref|YP_007830929.1|
Domain Number 1 Region: 328-722
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.46e-53
Family Phosphate binding protein-like 0.00032
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000166
Family GalR/LacI-like bacterial regulator 0.0069
Further Details:      
 
Domain Number 3 Region: 60-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000286
Family L-arabinose binding protein-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479202338|ref|YP_007830929.1|
Sequence length 723
Comment Transcriptional regulators [Roseburia intestinalis M50/1]
Sequence
MATIIDVARMAGVSQGTASNVLNGKGNVSSEKIKAVEEAAKKLGYTINERAKMLRKGSGN
IICVIVPSMERRHYRDFYYCLKSYAEKRGYTAELLITNDNRQTEYSMIQWAKSVMAMGVA
SITCLGEKEVKEAYAGFEKLCFVERKATDDLDYIGFDYESAGGQIAETVISARYHNVLVV
TDSLKFSNENEFCRGLYKMLAQEKIKFFHITTDSRRVSHAIINTLVQENEYDAIITTNIR
FAEKIRNVVTNFSAGNQTPIFTLSPITSLPEKDYRKYELNYGLVGKMAAEKIIGDSKENG
AEKELICENDGFREWNQITLNKTPADHLRILTLDSPETMILQGLAKLYTEETGTQIQFDV
FSYDDIYEQFMKAENSDYYDIFRMDVTWLPLLSERILVPLDDMTPDIDEVYKEYIPALID
KYSRVHGKAYALPITPSTQLLFYRKDLFENTVIKRLYSEKYKAELKIPKTFEEYNKIAEF
FATSDRLEEHYFSNLTLGNLGVTATEFLTRLFSHKNHLYGKDGMVVINDTAGVKALEELL
TAKQYTDKKVVHWWKTSAKDFADGKLVMMINFSNYASEILGAGSKVVGNIGVAMVPGKNP
IYGGGTVGISKNSRRKEDAFAFIKWITTEPAASGMAALGSVSPCAKTYNKYDIIDVFPWL
ELSKDCFSKSHTRRIPADSDKAFDEIKFLNIVGMAVENVLMGFLPVEESLNRAQKLIDEE
INK
Download sequence
Identical sequences D4KLY6 R6BA91
gi|479202338|ref|YP_007830929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]