SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479202651|ref|YP_007831242.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479202651|ref|YP_007831242.1|
Domain Number 1 Region: 64-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.57e-61
Family L-arabinose binding protein-like 0.0000789
Further Details:      
 
Domain Number 2 Region: 5-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000263
Family GalR/LacI-like bacterial regulator 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479202651|ref|YP_007831242.1|
Sequence length 343
Comment Transcriptional regulators [Roseburia intestinalis M50/1]
Sequence
MGSELNIYKIAQEAGVSPATVSRVMTKNARVSEEKRARVEAVIRKYDYRPNALAQGLIKT
KTNVIGVLAADLVNPYYSSMVENCEKEIIARGYVPMICGTLSNPDLEVEYIQKMFDMRMD
AIIIIGGKSDSLVTEPEYADLINRVAESIPVITTGKVEGGECCQVTIDEAEGMNQSMECL
IGLGHRRIALIGGVEEMKSTYDKRIRYRSLLRKNGLTYRERYVINSNYSVEGGYQGFEAL
FQGNKTLPTAVIAINDYSAVGVMRSIKEHGLRIPEDISLISFDNTFIVDTVIPRLSSISY
DYEAFGKLLVDTALDKIGGKEVPEVQKVTPTLIIRESVAELKR
Download sequence
Identical sequences A0A173SC55 C7G6Y0 D4KMU9 D4KZC3
gi|479202651|ref|YP_007831242.1| WP_006855782.1.14300 WP_006855782.1.8661 gi|479148061|ref|YP_007778490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]