SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479202813|ref|YP_007831404.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479202813|ref|YP_007831404.1|
Domain Number 1 Region: 58-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.26e-60
Family L-arabinose binding protein-like 0.0000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479202813|ref|YP_007831404.1|
Sequence length 353
Comment monosaccharide ABC transporter substrate-binding protein, CUT2 family (TC 3.A.1.2.-) [Roseburia intestinalis M50/1]
Sequence
MKSRGYGFGGDMLNKRWVSAGITVLGAIFLLAGCGEKRGQRTNGLDTEEMAGHDGCIVVG
YAQVGSESDWRTTNTQSFKNIFTEENGYYLIFEDGQQKQENQVKAIRNFILQDVDYIILD
PVVETGWEAVLEEAKEAGIPVILSDRTVEVGDESLYSCWVGSNFCEEGIKAGEWLENYLK
EQGREDETIHLVTLQGTSGSSAQIGRSDGFEKILKKHSDWVMLEKQSGDFTQAKGQEVME
DFLEKYDDIDVVISENDNMTFGVIDALEAAGKKMGTDGDVIVISFDAVKDALTVMQDEKI
MADFECNPLTAPLVEQTIRHMENGEEVDKVQYVEEGYFDYTMDLKSILKDRSY
Download sequence
Identical sequences C7GA76 D4KNB1 D4KZS2
gi|479202813|ref|YP_007831404.1| WP_006856930.1.14300 WP_006856930.1.8661 gi|479148210|ref|YP_007778639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]