SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479204159|ref|YP_007832750.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479204159|ref|YP_007832750.1|
Domain Number 1 Region: 2-285
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-43
Family L-arabinose binding protein-like 0.00029
Further Details:      
 
Domain Number 2 Region: 488-636
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.02e-30
Family GGDEF domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479204159|ref|YP_007832750.1|
Sequence length 642
Comment diguanylate cyclase (GGDEF) domain [Roseburia intestinalis M50/1]
Sequence
MKKIALIMDGWKRWFTFAWPAGILQRIRQTGEEVSLYIFNSSGGWSCDEEYNTGEYNIYR
LPDLREFDGIILDLNNIGYPEVWEDVIRRAKESGVPVISIANEIEDFYYVGINNEKAMRM
MIEHLYEKHGCKKYWFVMGPEDNYENVKRIAALRAYMDEKQLTYSESDFYCESFEYQCGV
NGFEKLLETHDKGRLPQAIICGNDNIAVGVCEAATAHGYQVPKDFCVTGFDNFDKAAYYE
PRISTISHIRENVGIACVDLFLHIWKGEKPDRFYYTDTEGIFWDSCGCMPGEVPDQAEYL
KGQVMYGIETARFEDEVFSLEYELLKCNTVREMMYCIPQCIPSLKCDAMYLILDSHMDTY
KEQVKTHRSLSFFEEEDFHVEGYPKCMQVKFAYKNGKMLDTDQMEIEGIFPFFEPQKGGT
DFLFLPMHFRNRTVGYFVIENAVYLMEKQYLFQVIKTLTNAMENLHKKEKLEHMNQILSD
LYVRDSVTGLYNRMGYQKLSISYFTIMREKKMPVLVMFIDLDRLKYINDTFGHEYGDFAI
VSIAKAMLKHCDADAIAARTGGDEFIVLEGAKDEESGRVLAQKIRTELSKTQRAMQLPFD
LSASIGAVVAHPGEENVLESYVKRAEMLMYEEKAEKKVSRDS
Download sequence
Identical sequences D4KS57
gi|479204159|ref|YP_007832750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]