SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479204203|ref|YP_007832794.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479204203|ref|YP_007832794.1|
Domain Number 1 Region: 81-362
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1e-59
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Domain Number 2 Region: 5-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.4e-22
Family GntR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479204203|ref|YP_007832794.1|
Sequence length 367
Comment transcriptional regulator, GntR family [Roseburia intestinalis M50/1]
Sequence
MDKKLKYYDLMEDLRKQIVSGKIKPGEKLPSENELSGTYQVSRQTVRKALQILQNEGYIY
AEHGRGTFCSEMARRTGETKNIAVVTTYLSDYIFPRVIQGIDKVLTENGYSILLKNTRNS
RNMEAKCLEELLQKGIDGLIIEPSKSQIFCKHINLYQTLDEYRIPYVFIQGSYAQLAEKP
HILLDDCLGGYLVTRYLISLGHHHIIGIFKADDTQGQQRHKGYVQALQEAGIAYDPDKVV
WFYTEDRKTHPYEQMCHMAKMRCEHFFDSVVSYNDQIALEVIRALEDEGLKVPDDVSVTG
YDDSYLASSGKVPLTTVAHPQEKLGEMAAELLLGLLKEGNIPESERQILVKPELVIRESC
RSRKKEE
Download sequence
Identical sequences A0A1Q6SA87 D4KSA1 D4L3E1 R6BVQ3
gi|479204203|ref|YP_007832794.1| gi|479149479|ref|YP_007779908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]