SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110667962|ref|YP_657773.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110667962|ref|YP_657773.1|
Domain Number 1 Region: 11-61,200-401
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.01e-40
Family Bacterial dinuclear zinc exopeptidases 0.013
Further Details:      
 
Domain Number 2 Region: 81-191
Classification Level Classification E-value
Superfamily PA domain 0.00000000034
Family PA domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110667962|ref|YP_657773.1|
Sequence length 439
Comment peptidase [Haloquadratum walsbyi DSM 16790]
Sequence
MTDWIGETFTSNIGWKHLERLVDIDIRMAGSGGERHAAEVTRDALTAVGARNAHLEEFEI
QGWARESAAIHAGDTAQDCIALPRSPSGNAMGELVDIGHGLPADFDCDLNEKVILAASDI
PDWHDRYVHRREKYYRAVNAGASAFIYRNHVNGCLPPTGSVGTEEAPIGEIPAVGVSKEV
GKRLSRRFTGDDVVVNTHVDIYDTTSQNIHADLGPKTENAVFLTSHVDAHDIGEGAADNA
AGTAIVLEVARALAQRESELDTRVHLLVYGAEEIGLVGSQYDADSRDHETIKAIVNNDGV
VRNRTLVCHAHGFDDLIDAADRVAARMDHPIDVPPELNPHSDHWPYVTWGVPGYHIRADT
GDVGRGWGHTHADTLDKLSVRDLREQAILLTELVIELASDDTTVAHRPPSAIADQLEREN
RAEGMQVIGDWPYTKTIDR
Download sequence
Identical sequences Q18IM8
362976.HQ2014A WP_011571283.1.31310 gi|110667962|ref|YP_657773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]