SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110668625|ref|YP_658436.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110668625|ref|YP_658436.1|
Domain Number 1 Region: 3-247
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.14e-46
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00071
Further Details:      
 
Domain Number 2 Region: 264-456
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.84e-40
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110668625|ref|YP_658436.1|
Sequence length 473
Comment 5'-nucleotidase; 2',3'-cyclic-nucleotide 2'-phosphodiesterase; UDP-sugar hydrolase [Haloquadratum walsbyi DSM 16790]
Sequence
MPRLLQYSDVENVFDNPRQAGRLAGAIRTRNDDHTIICGTGDNTAPGVLALIDRGQQALE
LFEAINTDVETFGNHDFDFGIEAIQSIIAASPQTWVSTNIYHQDDDGTAGERFAANDSVP
TTIESVNKETVGFIGVTDPATPSLNPMADELYFTDPYNAAKKAVRKLQAADIDYIVALSH
LGSGDDKLARQTDIDVILGGHLHTKRHEWVDGTLCVRPGAGGKTITEVTLNNGDITATQH
ETATAPLADDVVSALQGRIDAAGLDQVVAHTSQPLERTHSDVFAGESRIGNFVADAYRWA
LDTDIGLQNSGGIRNGPALSGDITTADLMSVVPFNEHIVCAEITGETLRAVLRESAASVV
DFGEPGWWHSHLSGARVVWDEDAETIQAASVDNQPIAPRQSYTLATSAYVLHSDHEFPTL
TNRHRVDEGGIQFEILIEYAREQGVDVAVEGRVKRIGSSDSQSASQSSSATTD
Download sequence
Identical sequences Q18GR5
WP_011571946.1.31310 gi|110668625|ref|YP_658436.1| 362976.HQ2723A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]