SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110669122|ref|YP_658933.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110669122|ref|YP_658933.1|
Domain Number 1 Region: 10-144
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 4.71e-46
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00012
Further Details:      
 
Domain Number 2 Region: 146-276
Classification Level Classification E-value
Superfamily Translational machinery components 1.44e-39
Family ERF1/Dom34 middle domain-like 0.00059
Further Details:      
 
Domain Number 3 Region: 279-414
Classification Level Classification E-value
Superfamily L30e-like 3.94e-32
Family ERF1/Dom34 C-terminal domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110669122|ref|YP_658933.1|
Sequence length 416
Comment peptide chain release factor 1 [Haloquadratum walsbyi DSM 16790]
Sequence
MSTDAEDVSNDRRKYEFRKVIEELREYEGSGTQLVTIYIPPDRQVSDVVAHITQEHSEAS
NIKSKQTRTNVQDALTSIKDRLRYYDTYPPDNGIVLFSGAVSTGGGQTTMVTRSLESPPE
PVQSFRYHCDSDFLTDPLEDMLADKGLFGLIVLDRREANVGWLKGKRVEPVKSASSLVPG
KQRKGGQSAQRFARLRLEAIDNFYQEVAGMANDLFVPKRHEIDGVLVGGPSPTKDEFLDG
DYLHHELGDVVVGKFDVSYTDESGLHDLVDSAQDVLADQEVMKDKAEMEEFFEKLHGGEE
ATYGFEPTRKNLMMGAVDRLLLSEDLRSDVVVYECPDGHEEYEVIDRRHDDPEHTCSDCG
SASEKTEREDVIEYLMSIAEQRGTETKFISTDFEKGEQLHNAFGGIAGILRYATGI
Download sequence
Identical sequences G0LN65 Q18FC0
362976.HQ3241A gi|385804722|ref|YP_005841122.1| WP_011572443.1.31310 WP_011572443.1.96088 gi|110669122|ref|YP_658933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]