SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110669216|ref|YP_659027.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|110669216|ref|YP_659027.1|
Domain Number - Region: 6-32
Classification Level Classification E-value
Superfamily Transposase IS200-like 0.000576
Family Transposase IS200-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110669216|ref|YP_659027.1|
Sequence length 49
Comment IS200-type transposase (nonfunctional,N-terminal part), partial [Haloquadratum walsbyi DSM 16790]
Sequence
MGETRSNHTVYNINYHFVWCCQSEIDCLQIGDLQCRKYRRSVLDEIEQS
Download sequence
Identical sequences 362976.HQ3340A gi|110669216|ref|YP_659027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]