SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145219266|ref|YP_001129975.1| from Chlorobium phaeovibrioides DSM 265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145219266|ref|YP_001129975.1|
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily Folate-binding domain 1.08e-99
Family Aminomethyltransferase folate-binding domain 0.000000423
Further Details:      
 
Domain Number 2 Region: 275-362
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.5e-19
Family Aminomethyltransferase beta-barrel domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145219266|ref|YP_001129975.1|
Sequence length 365
Comment glycine cleavage system aminomethyltransferase T [Chlorobium phaeovibrioides DSM 265]
Sequence
MKKTSLSSWHEKAGAKIIDFGGWLMPVQYSGIMAEHKAVRSAAGLFDVSHMGNFYVKGRR
ALEFLQSVTTNDLSRTVDGQAQYTIMLYENGGIVDDLIIYRIDSVTFFLIVNAGNCDKDF
AWLEEHAGAFEGVQLSNHSDQLSLIALQGPKAFSILSRVIPEIDADRLPSFHFRQLPFMG
AELMVARTGYTGEAGVEICLPNALAQPLWEALLDAGREDGLVPVGLGARDTLRLEMGYSL
YGHEIDQDTNPLEARLKWVVSMEKGPFIGREACRQVELDPRFGVAGFSLEGRALARQGCR
VFNADRQEIGKVCSGTISPTLQEPIGTASLVREYLKPGTPVFVEIRGSLQPGQIRRLPFV
KPALL
Download sequence
Identical sequences A4SDB4
WP_011889701.1.67172 gi|145219266|ref|YP_001129975.1| 290318.Cvib_0451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]