SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145219514|ref|YP_001130223.1| from Chlorobium phaeovibrioides DSM 265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145219514|ref|YP_001130223.1|
Domain Number 1 Region: 2-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.1e-95
Family Methylenetetrahydrofolate reductase 0.000000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145219514|ref|YP_001130223.1|
Sequence length 289
Comment 5,10-methylenetetrahydrofolate reductase [Chlorobium phaeovibrioides DSM 265]
Sequence
MLVKEILNTAHKPVFSFEFFPPKKDADWETLFETITALSPLNPSYVSVTYGAGGSTRTRT
HDLVTRIQKETGLSVVSHLTCIASTSGETGEILENYQSHGINNVLALRGDKPTGTESIAD
AVKDFPHAIDLVRFIKNNHPDIGVGVAGFPEGHPETPNRLQEIEYLKAKVDAGADYIVTQ
LFFDNRDYFDFVDRCRLAGISVPIIPGIMPVTSTKGMTRMSELALGARIPAPLLKKVLGA
ENDAQVASIGIEWATNQVQELIDNQIRGIHFYTLNMATATLEIFQNLHS
Download sequence
Identical sequences A4SE12
WP_011889947.1.67172 290318.Cvib_0706 gi|145219514|ref|YP_001130223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]