SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145220560|ref|YP_001131269.1| from Chlorobium phaeovibrioides DSM 265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145220560|ref|YP_001131269.1|
Domain Number 1 Region: 238-573
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.29e-94
Family beta-Lactamase/D-ala carboxypeptidase 0.0000352
Further Details:      
 
Domain Number 2 Region: 58-237
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 8.37e-34
Family Penicillin binding protein dimerisation domain 0.001
Further Details:      
 
Domain Number 3 Region: 599-654
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145220560|ref|YP_001131269.1|
Sequence length 664
Comment peptidoglycan glycosyltransferase [Chlorobium phaeovibrioides DSM 265]
Sequence
MHDEPNIPSAGESLFARRIGGVVLGFVLFLAGLVAMLFHIQIIEGGGYRDKAARQYLREV
TSVASRGDILDRRGRMLAESIESVSFYADPRIVRRTPHPRGNGRQGTFDNSSHIASLFAR
HLGGSRQSYLKELRKSRGVAVLGRKIPIAKAMELMNEKIPGVWFDREHQRYYLNVAAQLI
GVTNSSNHGISGIELKLDRELRGRDGTTVYQRTATGEKFPAPDARQQEALKGKTVELTID
GDIQSVVEDELAGIVSKYNAAAATGIVMEVKTGEILAMANSPTFNLNNRSTWTPEKARNR
SVTDSFEPGSTFKIVMAAAATDELHMKAGDMVFAHNGTLPVYRLKITDHEPYGDISFREA
IMYSSNIVAAKIAMEVGGEKFHEYVRRFGFGSKTGVGLIGELPGKVKPLKEWSGTTLPWM
GYGYEVMTTPLQILQAYAAVANGGVLMRPRIIRKVREPDGRVVSESKPEEVRRVMSKRSA
DYLSREYFRAVVDSGTAVSAAIRGISVAGKTGTAQRVTDGSYRSRVYVSSFVGYFPVEDP
RYAIIVLVEDPKPAYYASTVAAPSFSSIASRMIACSGELQQNLSMHSAEQEELRSIRTVA
VPELAGMSADDAKRLLRWLGLRMDVSGERKGFVVAQSIAPGSRVEKKRTITVTIADQDME
RRTM
Download sequence
Identical sequences A4SH08
290318.Cvib_1759 WP_011890989.1.67172 gi|145220560|ref|YP_001131269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]