SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126447880|ref|YP_001077427.1| from Burkholderia mallei NCTC 10247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126447880|ref|YP_001077427.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.44e-107
Family FMN-linked oxidoreductases 0.0000000021
Further Details:      
 
Domain Number 2 Region: 335-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.59e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000162
Further Details:      
 
Domain Number 3 Region: 464-522,558-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-24
Family C-terminal domain of adrenodoxin reductase-like 0.0000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126447880|ref|YP_001077427.1|
Sequence length 677
Comment FAD/FMN-binding/pyridine nucleotide-disulfide domain-containing oxidoreductase [Burkholderia mallei NCTC 10247]
Sequence
MTTPFPHLLAPLDLGFTTLRNRVLMGSMHTGLEDSRKTLPRLADYFAERARGGVGLIVTG
GFAPNVAGWTKPFGGTLSTGAAARRHRVIPDAVHAHGGKIALQILHTGRYGYHPFAVAPT
RLKSPISPFTPHELSARGIERQIRAFVRCAQLAREAGYDGVEIMGSEGYLINQFISLHTN
KRTDEWGGSYANRMRLPVEIVERTREAVGRDFIIVYRLSMLDLIPDGSNWDEVVLLAKAV
ERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGEVGIPLVTTNRINRPEIAEQ
ILADGCADMVSMARPFLADAEFVKKAAEGRVDEINTCIGCNQACLDHAFKNQIASCLLNP
RACHETELNYTRAASAKRVAVIGAGPAGLACATVLAQRGHRVELFDAAAEIGGQFNMAKR
IPGKEEFHEALRYFARQIELAGVQLRLNRRVDAAELIAAGYDDVVLATGVAPRNPRIPGQ
DHPKVLTYIDVLARNKPVGERVAVIGAGGIGFDVSEFLVQDGESPALDLDAWKAEWGVTD
PALARGGVVRGEVAPPARRVTLLQRKATGLGKGLGKTTGWIHRATLKMKQVEMIGGVNYE
LIDDKGLHVTFGKERRDPTVIEADTIVLCAGQEPERALYEPLKAAGVPVHLIGGAELAAE
LDAKRAIDQGARLAARL
Download sequence
Identical sequences A0A0F6G3V3 A0A0F6L4Y3 A0A0H2WBL9 A0A290YJ51 A0A2K3FK26 A0A2K3GL22 A0A2K3HS51 A0A2K3IHM2 A2S091 C4AVF3
gi|126447880|ref|YP_001077427.1| 243160.BMAA0192 320388.BMASAVP1_1367 320389.BMA10247_A0222 412022.BMA10229_1562 gi|121597310|ref|YP_990963.1| gi|556572283|ref|YP_008741089.1| gi|124383300|ref|YP_001025362.1| WP_004190520.1.100104 WP_004190520.1.100727 WP_004190520.1.10746 WP_004190520.1.11072 WP_004190520.1.11747 WP_004190520.1.1266 WP_004190520.1.13198 WP_004190520.1.13925 WP_004190520.1.15696 WP_004190520.1.16090 WP_004190520.1.18549 WP_004190520.1.19540 WP_004190520.1.19842 WP_004190520.1.19854 WP_004190520.1.20531 WP_004190520.1.20673 WP_004190520.1.21442 WP_004190520.1.22329 WP_004190520.1.22625 WP_004190520.1.23086 WP_004190520.1.2317 WP_004190520.1.23385 WP_004190520.1.2404 WP_004190520.1.26445 WP_004190520.1.28453 WP_004190520.1.29148 WP_004190520.1.29178 WP_004190520.1.31723 WP_004190520.1.31831 WP_004190520.1.3251 WP_004190520.1.33158 WP_004190520.1.33419 WP_004190520.1.33543 WP_004190520.1.34747 WP_004190520.1.35757 WP_004190520.1.35878 WP_004190520.1.37517 WP_004190520.1.37702 WP_004190520.1.37934 WP_004190520.1.37959 WP_004190520.1.38946 WP_004190520.1.39349 WP_004190520.1.40021 WP_004190520.1.40426 WP_004190520.1.41477 WP_004190520.1.43899 WP_004190520.1.44179 WP_004190520.1.44540 WP_004190520.1.4810 WP_004190520.1.48313 WP_004190520.1.48407 WP_004190520.1.50336 WP_004190520.1.50401 WP_004190520.1.53386 WP_004190520.1.53977 WP_004190520.1.54892 WP_004190520.1.56993 WP_004190520.1.57679 WP_004190520.1.58105 WP_004190520.1.58355 WP_004190520.1.60969 WP_004190520.1.61073 WP_004190520.1.61588 WP_004190520.1.61854 WP_004190520.1.63719 WP_004190520.1.64683 WP_004190520.1.66380 WP_004190520.1.66594 WP_004190520.1.67013 WP_004190520.1.67393 WP_004190520.1.67909 WP_004190520.1.69106 WP_004190520.1.69508 WP_004190520.1.70096 WP_004190520.1.72545 WP_004190520.1.72798 WP_004190520.1.73906 WP_004190520.1.74675 WP_004190520.1.75230 WP_004190520.1.75861 WP_004190520.1.76432 WP_004190520.1.76575 WP_004190520.1.77845 WP_004190520.1.78557 WP_004190520.1.79653 WP_004190520.1.80098 WP_004190520.1.82283 WP_004190520.1.82323 WP_004190520.1.84063 WP_004190520.1.84480 WP_004190520.1.85170 WP_004190520.1.85490 WP_004190520.1.85645 WP_004190520.1.86872 WP_004190520.1.9236 WP_004190520.1.9281 WP_004190520.1.92904 WP_004190520.1.94403 WP_004190520.1.95054 WP_004190520.1.95952 WP_004190520.1.96381 WP_004190520.1.96660 WP_004190520.1.98066 WP_004190520.1.98218 WP_004190520.1.98753 WP_004190520.1.9975 WP_004190520.1.99919 YP_105019.1.87047 gi|53716523|ref|YP_105019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]