SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262192865|ref|YP_001077664.2| from Burkholderia mallei NCTC 10247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262192865|ref|YP_001077664.2|
Domain Number 1 Region: 63-310
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000000017
Family Tricorn protease N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|262192865|ref|YP_001077664.2|
Sequence length 352
Comment YD repeat-containing protein [Burkholderia mallei NCTC 10247]
Sequence
MGRTVGRASAMIDPAGRTTAWEYDAYGSLLVQTLPDGSAVRTEFDLDHRPVCMTLIGGRQ
WGYEWNTFGNLLAQSDPSGAISRYTYDEYGQLVEHTGPRGASTRFDYHPDGNLAAQIDAL
GHRTQYRYDARGYLGEAIDALGQQSQYEYDRNGHLTRAIEPGGREIHCAYDADGNLSRHR
DPMGHVTQMEYSALGQVSRRLAPDGTTVEYRYDTEEQLIGVVNERSELYALERDALGRIV
VETDYWGQARRYRYGAAGELLCSTDPLGQTVEYRYDWLGRIVQKRVPHPEQDEALQIDSF
AYDRHGDLVLAENPSCRVEFDYDAAGRMIEERQGDDFTIASDYDEAVTCPLR
Download sequence
Identical sequences A2S0X0 C4ASD2
gi|262192865|ref|YP_001077664.2| 320389.BMA10247_A0462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]