SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262193278|ref|YP_001081486.2| from Burkholderia mallei NCTC 10247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262193278|ref|YP_001081486.2|
Domain Number 1 Region: 158-430
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 7.06e-53
Family Tricorn protease N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 33-162
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 5.89e-32
Family TolB, N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262193278|ref|YP_001081486.2|
Sequence length 433
Comment translocation protein TolB [Burkholderia mallei NCTC 10247]
Sequence
MSLMTKLGFRALVASCLIAAGGAAHAQVNVLITGVGSTQFPIATANFVNEASLPQQVTSV
VRGDLARSGKFSNVDAGSTPVPETASVDFGAWKAKGANAFVAGSVNREPNGQYKVNFILY
DTVKQQSLGGLSLTTSNDNEGMRKTGHKIADYIYQKLLGVRGVFNTRLSYVQRTGNVYKL
LISDSDGQNAIPALTSKEPIISPAWSPSGTKVAYVSFELRKPVVYIHDLPTGRRYVISNQ
KGNNSAPAWSPDGQTLAVALSLTGNTQIYSVSSTGTGLRRLTRSSSIDTEPFYSPDGKWI
YFTSDRGGAPQIYRMPAEGESAGAAQRVTFTGSYNTSPRVSPDGKLLAYISRTGGGFKLY
VQDLQSGAANAVTNTTRDESPSFAANGQYILYARQSGGRSVLAAVPSDGSAPPQILSVQG
GAIREPSWGPFMQ
Download sequence
Identical sequences A0A290YAV0 A2S9J4 Q62I10
243160.BMA2081 320389.BMA10247_1949 gi|53725631|ref|YP_103660.1| gi|262193278|ref|YP_001081486.2| WP_004203722.1.100104 WP_004203722.1.100727 WP_004203722.1.13925 WP_004203722.1.20531 WP_004203722.1.21442 WP_004203722.1.22329 WP_004203722.1.22625 WP_004203722.1.23385 WP_004203722.1.26445 WP_004203722.1.28453 WP_004203722.1.29148 WP_004203722.1.3251 WP_004203722.1.33419 WP_004203722.1.33543 WP_004203722.1.34747 WP_004203722.1.35757 WP_004203722.1.35878 WP_004203722.1.38946 WP_004203722.1.39349 WP_004203722.1.40191 WP_004203722.1.41477 WP_004203722.1.43899 WP_004203722.1.44540 WP_004203722.1.4810 WP_004203722.1.48313 WP_004203722.1.48407 WP_004203722.1.53977 WP_004203722.1.54892 WP_004203722.1.57679 WP_004203722.1.61073 WP_004203722.1.61588 WP_004203722.1.66594 WP_004203722.1.67393 WP_004203722.1.69508 WP_004203722.1.72545 WP_004203722.1.72798 WP_004203722.1.74675 WP_004203722.1.75230 WP_004203722.1.75861 WP_004203722.1.78557 WP_004203722.1.79653 WP_004203722.1.82283 WP_004203722.1.84063 WP_004203722.1.84480 WP_004203722.1.9236 WP_004203722.1.9281 WP_004203722.1.95952 WP_004203722.1.96660 WP_004203722.1.98066 YP_103660.1.87047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]