SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126445825|ref|YP_001077568.1| from Burkholderia mallei NCTC 10247

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126445825|ref|YP_001077568.1|
Domain Number 1 Region: 9-211,255-393
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.6e-81
Family TK-like PP module 0.0054
Further Details:      
 
Domain Number 2 Region: 329-514
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.45e-61
Family TK-like Pyr module 0.076
Further Details:      
 
Domain Number 3 Region: 503-635
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.96e-31
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126445825|ref|YP_001077568.1|
Sequence length 651
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Burkholderia mallei NCTC 10247]
Sequence
MGAQEVRARLFSYNGTTMYDLLKTIDDPADLRRLDRRQLQPLADELRAFVLDSVSKTGGH
LSSNLGTVELTIALHYVFNTPDDRIVWDVGHQTYPHKILTGRRDGMKTLRQFDGISGFPR
RSESEYDTFGTAHSSTSISAALGMAIGSKLNGDDRFSIAVIGDGAMTAGMAFEAMNNAGV
SEDAKLLVILNDNDMSISPPVGALNRHLARLMSGRFYAAARAGVERVLSVAPPVLELARK
LEEHAKGMVVPATLFEEFGFNYIGPIDGHDLDSLIPTLQNIKELRGPQFLHVVTKKGQGY
KLAEADPVLYHGPGKFNPAEGIKPSTTPAKKTYTQVFGEWLCDAAELDARVVGITPAMRE
GSGMVEFEKRFPERYYDVGIAEQHAVTFAGGLATEGLKPVVAIYSTFLQRAYDQLIHDVA
LQNLPVVFAIDRAGLVGADGATHAGAYDLAFLRCIPNMTVMAASDENECRQMLHTALQQP
NPTAVRYPRGAGTGVATVKAFTEIPLGKGEVRRRTSQPDGKRIAILAFGTMVAPSLAAAD
ALDATVANMRFVKPIDAELVQALARTHDYLVTVEEGCVMGGAGSACVEAMMESGAVRPVL
QLGLPDRFVDHGDPAKLLSLCGLDGDGIAKSIRERFLSHAADVASPAKRVA
Download sequence
Identical sequences A2S0N5 C4AQJ3
320388.BMASAVP1_1512 320389.BMA10247_A0364 412022.BMA10229_1706 gi|121596455|ref|YP_991107.1| gi|126445825|ref|YP_001077568.1| gi|124381982|ref|YP_001025505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]