SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146299894|ref|YP_001194485.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146299894|ref|YP_001194485.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.92e-59
Family PP-loop ATPase 0.0000278
Further Details:      
 
Domain Number 2 Region: 345-431
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000209
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146299894|ref|YP_001194485.1|
Sequence length 436
Comment tRNA(Ile)-lysidine synthetase [Flavobacterium johnsoniae UW101]
Sequence
MLSKFQNHIVSKFPFLKQKKLFLAVSGGLDSMVLLHLFKQLNYEITVLHCNFQLRGLESF
GDQEFIQNYCDKNNIKIFTTQFDTQAFAEDYKLSIQVAARELRYSWFYELLEEKHFDYLL
TAHHADDNLETFIINLTRGTGLDGLTGIPEQNDKIIRPLLPFSREEILKYAQENNIEWRE
DSSNASTKYVRNKIRHDLVPVLKQINPNFLDAFQKTQSFLQESKEMVEDASIVIYQQVAK
EAGDDIHFDLNQLKKLPNYKSYLYQWLNEFGFSAWKDIYDLVEGQSGKQVFSDEFRLLKN
REILILTPISETSEKEEFEIYENDTEVNFPLKMTLCNVGHTTFGSNRTIFVDAEKIQFPL
KLRKWNEGDVFQPFGMNGKSKKVSKLFKDEKMSLIEKEKTWILSSDDQIVWIVGIRQDER
FKINNTTNKILKIELQ
Download sequence
Identical sequences A5FHZ6
376686.Fjoh_2138 WP_012024205.1.25392 WP_012024205.1.49882 WP_012024205.1.53833 gi|146299894|ref|YP_001194485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]