SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146300717|ref|YP_001195308.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146300717|ref|YP_001195308.1|
Domain Number 1 Region: 213-409
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.41e-69
Family B3/B4 domain of PheRS, PheT 0.0000049
Further Details:      
 
Domain Number 2 Region: 44-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.92e-41
Family Myf domain 0.0042
Further Details:      
 
Domain Number 3 Region: 480-701
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-31
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0011
Further Details:      
 
Domain Number 4 Region: 708-806
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.83e-29
Family Anticodon-binding domain of PheRS 0.00083
Further Details:      
 
Domain Number 5 Region: 417-488
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000119
Family Domains B1 and B5 of PheRS-beta, PheT 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146300717|ref|YP_001195308.1|
Sequence length 806
Comment phenylalanyl-tRNA synthetase subunit beta [Flavobacterium johnsoniae UW101]
Sequence
MKISYNWLKQFIKTDWTSEQTSELLTDLGLEVEVVEKYQSIKGGLEGVVVGHVLTCEKHP
DADRLKVTTVNIGLEAPVQIVCGAANVAAGQKVPVATIGTVLYDKEGTEFTIKKGKIRGQ
DSHGMICAEDELGLGTSHDGIMVLDENLVPGTPASEVFQIANDEVFEIGLTPNRADAMSH
FGTARDLRAGMLQRGVNIELITPSVSNFRVDMRTLKIDVNVEEPALAPRYCGVTISGITV
QESPNWLQDRLKAIGLTPKNNIVDVTNYVLHELGQPLHAFDAAKINGKVIVKTLPAGTKF
TTLDDVERTLHAEDLMICDEKGPLCIAGVFGGKKSGVSEGTTAIFLESAYFDAVSVRKTA
KRHQLNTDASFRFERGIDPTITEYALKRAALLIQEVAGGKITSDVVEVYPKKVEDFSVLL
NFSHVSKIIGQEIPKDTIKKILVSLDIKVNSVSDTGLGLTIPAYRVDVQREIDVIEEILR
VYGYNNIEFSKKFNATVANSPRTEDYKVQNVIASQLNSQGFHEMMANSLTTAAYAKLSTA
LKEEHNVTMLNPLSSDLSTMRQSLLFSALEAVSYNINRRNSDLKLFEFGKSYHKYLNGYE
EHKHLTLSISGNRNKESWTTPQKGTDFFLLKGYVKAVLARLGIEKISNAPVQSDIFSEGT
SICYNNDTLVEMGVVKKSILKHFGIKQDVYYADFNWDLVLKIITGKIKYTEIPKYPEVRR
DLALLIDEKTTYESIFNLARQTEKTLLKDINLFDVYQGNKLPEGKKSYALSFTIQDNTKT
LTDAQIDKIMSKLQQTFETELGASLR
Download sequence
Identical sequences A5FFM8
376686.Fjoh_2968 WP_012025027.1.25392 WP_012025027.1.49882 WP_012025027.1.53833 gi|146300717|ref|YP_001195308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]