SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146301093|ref|YP_001195684.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146301093|ref|YP_001195684.1|
Domain Number 1 Region: 10-191
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.14e-44
Family Methylesterase CheB, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146301093|ref|YP_001195684.1|
Sequence length 194
Comment CheB methylesterase [Flavobacterium johnsoniae UW101]
Sequence
MEENKIISNCRLTIIGGSAGSLNALMQILPELKRLHNFAVVIVLHRKSTDDQTLEELITL
KSSVPVKAVEDKTNLKPGFVYVAPSNYHLLFEKDDTMSLDISEKINYSRPSIDVSFESAA
EIYGNSLVGILLSGSNTDGTDGLKAIQAGGGKIVVQNPLSADMPFMPNNAILFTKPDYVL
NNKEILELLNSINT
Download sequence
Identical sequences A5FEK1
376686.Fjoh_3351 WP_012025334.1.25392 WP_012025334.1.49882 WP_012025334.1.53833 gi|146301093|ref|YP_001195684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]