SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146301330|ref|YP_001195921.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146301330|ref|YP_001195921.1|
Domain Number 1 Region: 12-81
Classification Level Classification E-value
Superfamily MtlR-like 0.00000068
Family MtlR-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146301330|ref|YP_001195921.1|
Sequence length 209
Comment hypothetical protein Fjoh_3588 [Flavobacterium johnsoniae UW101]
Sequence
METTRAKVIERAVGFEELISQLLSMLLEVDKNESRSFGHKNIALSFNAKINLLIDLKFIP
KEISKDFQLFAEIRNKFAHVLYVDSLVKCFEIIERRDYFLKKASDDISQVDKNDEAIYLT
AFELLCFELGIWLRVTLKMISTKKSQDLNKTGGIEMIRSFLQYDPTRREKELDNFIKTIQ
PVIDKITPDEEFLQEYERLLKKAKELKEE
Download sequence
Identical sequences A5FDX1
WP_012025569.1.25392 WP_012025569.1.49882 WP_012025569.1.53833 gi|146301330|ref|YP_001195921.1| 376686.Fjoh_3588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]