SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146302282|ref|YP_001196873.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302282|ref|YP_001196873.1|
Domain Number 1 Region: 16-311,418-449
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.03e-75
Family Type II chitinase 0.00000991
Further Details:      
 
Domain Number 2 Region: 1141-1469
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.33e-49
Family Type II chitinase 0.0068
Further Details:      
 
Domain Number 3 Region: 311-417
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000012
Family Chitinase insertion domain 0.0016
Further Details:      
 
Domain Number 4 Region: 642-718
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000216
Family Carboxypeptidase regulatory domain 0.063
Further Details:      
 
Domain Number 5 Region: 473-541
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.000000471
Family Cna protein B-type domain 0.012
Further Details:      
 
Domain Number 6 Region: 551-631
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000589
Family Rhamnogalacturonase B, RhgB, middle domain 0.032
Further Details:      
 
Weak hits

Sequence:  gi|146302282|ref|YP_001196873.1|
Domain Number - Region: 728-785
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.000392
Family Cna protein B-type domain 0.016
Further Details:      
 
Domain Number - Region: 834-909
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00118
Family Pre-dockerin domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146302282|ref|YP_001196873.1|
Sequence length 1578
Comment glycoside hydrolase [Flavobacterium johnsoniae UW101]
Sequence
MKHYYRLLFLLLFPLLASAQPAHGKKVVGYYAQWSIYARDFNVPKIDGSKLTHLNYSFYG
TTYDPAHPENTKLKCLDTYADFEHMEGGIPWDAPVKGNFYDLMKLKQKYPHLKILISVGG
WTKGQDLSPIAASPVARAALAADMANFIVTYPFIDGFDIDWEYPLSGGTDGTEIVNGMPV
PPQKYSPDDNKNLVLLLKAMRQAMPNKLVTIAAGNNVRNVSKQYLGPNNRAQYGMTEDIS
TYCDYITYFGYDFGGNWYDKTCYNAPLYASGNPNDPLYGATQSESLDELTNQYLNVIGFP
ANKLIMGLPFYGKKFDNVAANSTNGLFVAAPRYIVPGCTNPQNPTGTWDGSGACEKSGSI
EICDLVGNPVTNSHAYLDPNTMMVTPSAASAGWVRYFDNTTKVPYLYNSTLKQFISYEDK
QSMDLKVQYIKSRNLAGGMIWELSQDTRGSIPNSLLNQVDTSFGSVVPGTVSISGSVKNG
SALVTDVTVELRNASNAVIQTVVSANGNFAFNNLTSGQNYSLTALKATYTFTPVTLVNVT
VNQTAVVINGTQPTYTVSGTVLDGSTPVSGVTVTAVSGSTTLTAVSNASGVYSIAGLTAG
LNFTVTAAKSGFSYAPASTVYNAIDSNKTLNFTQGAPVVNYTVSGTVLNSTTPVSGVTVT
ASFTGGSYAAVTNASGTYSLSLPSGGNYTVTAALTGQTFTPASTVYSNLNANKTLNFTQD
VVVSTSKISGTVKNGTNPVAGAKVELVLPWTDNTHNWKSVIATTDAQGKYSFDNSVVDGY
TQVLSLKLNSWQNGEVAYYPNNLANFAVPANPTVYNFNTSSTAKSALAAAANLISGTVKN
GTTPVAGAKVEIVLPWTDNTHNWKSVLATTDASGNYSFDNSVVAGYTQILSLKLNGWENG
DVTYYPNNLANFAVPTTPTIYNFNRQAVVATKPVVTITAPTASAIAINLGSAINFVASVG
LSAVDATTISSVVFSLDGQSLSTANSSGTYTAAWTPAANQFSLSHTLTVTATASNGTTDS
KTYSFTLTCSGANCPNALPVITWNSPSNTTVYQNTFQVVPISVTAVDSDGTVSGVTITIN
GGTFNMTAGTNNTYTYNFTPSAYQDYPVVIKATDNKSGVTTLNNTIKIATVSTNRFIPLP
SKIILGYAHSWENAGAPFLYFSQMVGSKFNVVDYSFVETVNRDGYTPILTTNDTRYLTNG
VFNKQLLKNDIKSLRDSGVPVIVSIGGQNGHVVLDNVTQKNIFVNGLKAIIDEYQFDGVD
IDFEGGSMNFNAGGLRDISYAGISAYPRLKNVVDAFKELKAYYGPGFLLTAAPETQYVQG
GYTTYTDTFGSFLPIIQNLRNELDLLAVQLYNTGGENGLDGQYYGTAKKSNMVTALTDMV
IKGYNIASTGMRFDGLPASKVLIALPACPSAAGSGYLTPTEGINAMHYLRTGTTFSGRTY
TMQPGGPYPSLRGLMTWSVNWDASSCGNSSELSKAYAAYFASQTAAKTLVLDDISAKSNA
TIAYFKNNALSVTNENEDIAQVDVFNVLGQNLVSHRNVQNNKEVLLHNQSFSSKQLFLVV
VTDKAGNKKSFKVMNFLN
Download sequence
Identical sequences A5FB63
gi|146302282|ref|YP_001196873.1| 376686.Fjoh_4555 WP_012026520.1.25392 WP_012026520.1.49882 WP_012026520.1.53833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]