SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146302484|ref|YP_001197075.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302484|ref|YP_001197075.1|
Domain Number 1 Region: 21-255,319-351
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.1e-71
Family Type II chitinase 0.0000328
Further Details:      
 
Domain Number 2 Region: 255-317
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000534
Family Chitinase insertion domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146302484|ref|YP_001197075.1|
Sequence length 364
Comment glycoside hydrolase [Flavobacterium johnsoniae UW101]
Sequence
MKQINLIALLFCCILSTTTFAQKNKKFDIIAYYTGDSQLIDQYEVSKLNQIIFSFCHLKD
GKLSVDSAKDSLTIKHLVSLKAKNPQLKIIVSLGGWGGCEPCSDAFSTAEGRLKFAKSVK
EVSDYFKVDGLDLDWEYPSIEGLPGHLYQAADKPNFTELVKILRSTLGKKYELSFAAGGF
QKCLDESIDWKAVAPFVNRINIMSYDLVNGYSKVTGHHTPLYSTNPKEESTDRAVEFLLK
QGVPAEKLVIGGAFYTRQWKNVENINNGLYQAGEHFQGVDFKNYATTYTEANGWKYFWDD
KAKAPYWYNAQTKTFATSDDLKSIKAKTEYVKEKKLGGIMFWELTLDSFRNGMVDEIYKV
KTAK
Download sequence
Identical sequences A5FAK7
gi|146302484|ref|YP_001197075.1| WP_012026722.1.25392 WP_012026722.1.49882 WP_012026722.1.53833 376686.Fjoh_4757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]