SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146298046|ref|YP_001192637.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146298046|ref|YP_001192637.1|
Domain Number 1 Region: 7-315
Classification Level Classification E-value
Superfamily SIS domain 2.67e-62
Family mono-SIS domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146298046|ref|YP_001192637.1|
Sequence length 321
Comment KpsF/GutQ family protein [Flavobacterium johnsoniae UW101]
Sequence
MISKENILAIAKKTILSESEAITKLIDFLDENFFEAVQRIYETKGRLIVTGIGKSAIIAQ
KMVATFNSTGTPSMFLHAAEAIHGDLGMIQNDDIIICISKSGNSPEIKVLVPLLKRFGNT
LIAITGNTTSFLAKGSDFVLNTTVDTEACPINLAPTNSTTAQLVMGDALAVCLMEMRDFK
PEDFAVYHPGGALGKKLLLRVKDMIEHSLKPTVTPDTSVKKVIFEISEKRLGVTAVIEND
KIVGIITDGDIRRMLNDVDTIADLTAKDIMSKNPKVVSSETMAVDALNILEDFSITQLIV
ADNGEYKGVLHLHDILKEGIV
Download sequence
Identical sequences A5FNA5
gi|146298046|ref|YP_001192637.1| WP_012022388.1.49882 376686.Fjoh_0282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]