SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146302544|ref|YP_001197135.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302544|ref|YP_001197135.1|
Domain Number 1 Region: 9-247
Classification Level Classification E-value
Superfamily SIS domain 2.89e-70
Family mono-SIS domain 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146302544|ref|YP_001197135.1|
Sequence length 275
Comment N-acetylmuramic acid 6-phosphate etherase [Flavobacterium johnsoniae UW101]
Sequence
MKNKNPETEQESLYKDLDQMSVKELLTNINTEDKKVPHIIEEQIPKIEKLVKAIVKKMQL
GGRLFYIGAGTSGRIGILDASECPPTFGVPHDMIIGIIAGGDTAIRKAVENAEDDTEQAW
KDLAKFEISSLDMIIGIAASGNTPYVLGALKKAKEHNIKTGSISCISNGLIAQEADYPIE
LIVGPEFLTGSTRMKAGTAQKLTLNMISTSVMIKLGKVKGNKMVDMQLSNEKLVKRGIKM
IMEELNIEYDLAEELLHKHKSVRAVLLAQNKNQEI
Download sequence
Identical sequences A0A1M5J499 A5FAF8
WP_012026782.1.25392 WP_012026782.1.26696 WP_012026782.1.49882 WP_012026782.1.53833 gi|146302544|ref|YP_001197135.1| 376686.Fjoh_4817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]