SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126455316|ref|YP_001068251.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126455316|ref|YP_001068251.1|
Domain Number 1 Region: 647-1098
Classification Level Classification E-value
Superfamily ALDH-like 7.33e-127
Family ALDH-like 0.000000304
Further Details:      
 
Domain Number 2 Region: 258-606
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.96e-120
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000596
Further Details:      
 
Domain Number 3 Region: 88-257
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 4.18e-64
Family N-terminal domain of bifunctional PutA protein 0.000000408
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000000005
Family PutA pre-N-terminal region-like 0.001
Further Details:      
 
Domain Number 5 Region: 1143-1292
Classification Level Classification E-value
Superfamily ALDH-like 0.0000017
Family ALDH-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126455316|ref|YP_001068251.1|
Sequence length 1309
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Burkholderia pseudomallei 1106a]
Sequence
MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGVA
DLSDSHADGDDDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASL
ASDVQAMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDAL
IRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLI
RKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASY
EQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMNELLPRVRSLALLARRYD
IGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRS
RHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQF
ATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHE
TLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVEDALKVVPLGAPHAKIALPREL
YGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALAHAAPRDVRNPADLR
DVVGTVSEATPDEVSAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVR
EAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVA
AALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADPRTRA
VMFTGSTEVARLINKTLSSRLDPDGRPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSF
DSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSVDVGPVIDADAKRTIDT
HIAAMKDKGHAVTQLEMPDACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLD
KLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSG
TGPKAGGALYLQRLLATRPAGLPRSLEAALVADAPQEGETRDNPSAALTALRDWLIEQRE
PALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAALAT
GNRALFAGAAGEALAAALPAQLKAHAGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPG
PIVSVQGVAAGAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences A0A095P8B4 A0A0E1TR87 A0A0E1UUE0 A0A0E1W4F8 A0A2K3FD40 A0A2K3HJU0 A0A2K3IA11 A3P0Y0 A8EGS3 C4KY81 Q3JXX1 Q63PI8
gi|237814334|ref|YP_002898785.1| gi|403520667|ref|YP_006654801.1| 272560.BPSL3389 320372.BURPS1710b_0166 357348.BURPS1106A_4032 536230.GBP346_A4132 gi|53720995|ref|YP_109981.1| gi|76809424|ref|YP_331582.1| WP_004524499.1.100195 WP_004524499.1.10047 WP_004524499.1.100583 WP_004524499.1.100720 WP_004524499.1.100825 WP_004524499.1.101783 WP_004524499.1.102051 WP_004524499.1.10269 WP_004524499.1.10290 WP_004524499.1.10359 WP_004524499.1.10907 WP_004524499.1.11072 WP_004524499.1.11825 WP_004524499.1.11998 WP_004524499.1.1266 WP_004524499.1.12731 WP_004524499.1.12856 WP_004524499.1.13603 WP_004524499.1.13639 WP_004524499.1.14356 WP_004524499.1.14557 WP_004524499.1.15364 WP_004524499.1.15525 WP_004524499.1.16249 WP_004524499.1.16689 WP_004524499.1.17748 WP_004524499.1.17786 WP_004524499.1.18405 WP_004524499.1.18471 WP_004524499.1.18631 WP_004524499.1.18669 WP_004524499.1.18744 WP_004524499.1.18906 WP_004524499.1.19401 WP_004524499.1.19540 WP_004524499.1.19629 WP_004524499.1.1976 WP_004524499.1.19815 WP_004524499.1.21147 WP_004524499.1.21205 WP_004524499.1.21291 WP_004524499.1.21304 WP_004524499.1.21809 WP_004524499.1.21907 WP_004524499.1.22299 WP_004524499.1.2317 WP_004524499.1.23743 WP_004524499.1.24134 WP_004524499.1.24372 WP_004524499.1.2462 WP_004524499.1.25102 WP_004524499.1.25138 WP_004524499.1.25728 WP_004524499.1.26633 WP_004524499.1.26838 WP_004524499.1.27069 WP_004524499.1.27363 WP_004524499.1.27390 WP_004524499.1.2767 WP_004524499.1.27909 WP_004524499.1.28594 WP_004524499.1.28619 WP_004524499.1.28632 WP_004524499.1.29335 WP_004524499.1.29547 WP_004524499.1.29658 WP_004524499.1.29853 WP_004524499.1.29887 WP_004524499.1.29899 WP_004524499.1.29948 WP_004524499.1.30311 WP_004524499.1.3041 WP_004524499.1.3069 WP_004524499.1.31343 WP_004524499.1.32951 WP_004524499.1.33087 WP_004524499.1.33157 WP_004524499.1.34564 WP_004524499.1.35025 WP_004524499.1.35052 WP_004524499.1.35227 WP_004524499.1.35474 WP_004524499.1.36666 WP_004524499.1.37 WP_004524499.1.37373 WP_004524499.1.37627 WP_004524499.1.37690 WP_004524499.1.37806 WP_004524499.1.38115 WP_004524499.1.38442 WP_004524499.1.38490 WP_004524499.1.3872 WP_004524499.1.39162 WP_004524499.1.39179 WP_004524499.1.3947 WP_004524499.1.39757 WP_004524499.1.40021 WP_004524499.1.40045 WP_004524499.1.40235 WP_004524499.1.42408 WP_004524499.1.42492 WP_004524499.1.42496 WP_004524499.1.43136 WP_004524499.1.43156 WP_004524499.1.43727 WP_004524499.1.43786 WP_004524499.1.44234 WP_004524499.1.44414 WP_004524499.1.45890 WP_004524499.1.48165 WP_004524499.1.48464 WP_004524499.1.49026 WP_004524499.1.49717 WP_004524499.1.50636 WP_004524499.1.51902 WP_004524499.1.52229 WP_004524499.1.52643 WP_004524499.1.52655 WP_004524499.1.52731 WP_004524499.1.52760 WP_004524499.1.5292 WP_004524499.1.53034 WP_004524499.1.53048 WP_004524499.1.53386 WP_004524499.1.53506 WP_004524499.1.53578 WP_004524499.1.54016 WP_004524499.1.54369 WP_004524499.1.54804 WP_004524499.1.54859 WP_004524499.1.55415 WP_004524499.1.55974 WP_004524499.1.5608 WP_004524499.1.56126 WP_004524499.1.56248 WP_004524499.1.5641 WP_004524499.1.56458 WP_004524499.1.57096 WP_004524499.1.57247 WP_004524499.1.5734 WP_004524499.1.57341 WP_004524499.1.5776 WP_004524499.1.58105 WP_004524499.1.58405 WP_004524499.1.58523 WP_004524499.1.58758 WP_004524499.1.59103 WP_004524499.1.59255 WP_004524499.1.59422 WP_004524499.1.60398 WP_004524499.1.60810 WP_004524499.1.60969 WP_004524499.1.61084 WP_004524499.1.61723 WP_004524499.1.61854 WP_004524499.1.6186 WP_004524499.1.61900 WP_004524499.1.62103 WP_004524499.1.63361 WP_004524499.1.63379 WP_004524499.1.63505 WP_004524499.1.63661 WP_004524499.1.63942 WP_004524499.1.64204 WP_004524499.1.64383 WP_004524499.1.64542 WP_004524499.1.64683 WP_004524499.1.64892 WP_004524499.1.65832 WP_004524499.1.65994 WP_004524499.1.67117 WP_004524499.1.67182 WP_004524499.1.67559 WP_004524499.1.67860 WP_004524499.1.67914 WP_004524499.1.67978 WP_004524499.1.68515 WP_004524499.1.68886 WP_004524499.1.69094 WP_004524499.1.69106 WP_004524499.1.69217 WP_004524499.1.69354 WP_004524499.1.69918 WP_004524499.1.7006 WP_004524499.1.70066 WP_004524499.1.70096 WP_004524499.1.70280 WP_004524499.1.70735 WP_004524499.1.71444 WP_004524499.1.71564 WP_004524499.1.71901 WP_004524499.1.72015 WP_004524499.1.72817 WP_004524499.1.73317 WP_004524499.1.74177 WP_004524499.1.74425 WP_004524499.1.74690 WP_004524499.1.75075 WP_004524499.1.75677 WP_004524499.1.75711 WP_004524499.1.75883 WP_004524499.1.75937 WP_004524499.1.76142 WP_004524499.1.76522 WP_004524499.1.76575 WP_004524499.1.766 WP_004524499.1.77249 WP_004524499.1.77689 WP_004524499.1.78278 WP_004524499.1.78628 WP_004524499.1.78759 WP_004524499.1.78807 WP_004524499.1.78827 WP_004524499.1.79725 WP_004524499.1.79782 WP_004524499.1.80302 WP_004524499.1.80433 WP_004524499.1.80614 WP_004524499.1.80923 WP_004524499.1.8126 WP_004524499.1.81511 WP_004524499.1.81543 WP_004524499.1.81665 WP_004524499.1.82394 WP_004524499.1.82575 WP_004524499.1.83357 WP_004524499.1.83487 WP_004524499.1.83543 WP_004524499.1.83567 WP_004524499.1.83609 WP_004524499.1.83688 WP_004524499.1.8388 WP_004524499.1.8390 WP_004524499.1.8395 WP_004524499.1.84002 WP_004524499.1.84026 WP_004524499.1.84181 WP_004524499.1.84379 WP_004524499.1.85412 WP_004524499.1.85467 WP_004524499.1.85641 WP_004524499.1.86295 WP_004524499.1.86525 WP_004524499.1.86806 WP_004524499.1.87278 WP_004524499.1.87324 WP_004524499.1.88003 WP_004524499.1.89514 WP_004524499.1.91025 WP_004524499.1.91700 WP_004524499.1.91709 WP_004524499.1.91763 WP_004524499.1.92430 WP_004524499.1.9280 WP_004524499.1.93844 WP_004524499.1.94117 WP_004524499.1.94901 WP_004524499.1.94926 WP_004524499.1.95300 WP_004524499.1.9537 WP_004524499.1.95587 WP_004524499.1.95644 WP_004524499.1.95672 WP_004524499.1.97058 WP_004524499.1.97112 WP_004524499.1.98547 WP_004524499.1.98688 WP_004524499.1.98768 WP_004524499.1.98944 WP_004524499.1.99160 WP_004524499.1.99290 WP_004524499.1.9962 WP_004524499.1.99629 WP_004524499.1.99890 YP_109981.1.59693 gi|126455316|ref|YP_001068251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]