SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126451951|ref|YP_001066443.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126451951|ref|YP_001066443.1|
Domain Number 1 Region: 25-363
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.59e-97
Family Phosphate binding protein-like 0.00000000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126451951|ref|YP_001066443.1|
Sequence length 364
Comment putrescine ABC transporter periplasmic putrescine-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MKAKVAGRLTALALCAGATVAAAKDTQLNVYNWSDYIAKDTIPNFEKQTGVKVRYDNYDS
DDTLQAKLLTGNSGYDIVVPTSNYAGKQIQAGIFTPLDKSKLPNLKYLDAQLMALVAGAD
PGNKYVVPWAYGTTGLGYNVDKAQKVLGKVPLDNWDILFKPENLSKLKTCGVSVLDAPDQ
MFAATLHYIGKDPMSTNPADYQAAMQVLKKIRPYITQFNSSGYINDMVGGDICFAFGWSG
DVVIAKHRALEAKKPYKLEYYVPKGGAPVWFDVMAIPKDAKNKDAALQWINYIEDPKVHA
SITNAVYYPSANAQARKYVRPDVANDPAVYPPPDVVKTLFLLKPLPPEIQRLQTRLWTEL
KSGR
Download sequence
Identical sequences A0A069B8H1 A0A0E1TXV6 A0A0E1WKK0 A0A0F6GIJ2 A0A0F6LAC7 A0A0H3HIC0 A0A2K3FME9 A0A2K3GK28 A0A2K3HUU6 A0A2K3IJH6 A3N9Y7 A3NVS2 B1HJH7 C4KMK7 Q3JRU8 Q63UP1
gi|126439547|ref|YP_001059158.1| WP_004521361.1.100195 WP_004521361.1.10047 WP_004521361.1.100583 WP_004521361.1.100720 WP_004521361.1.100825 WP_004521361.1.100900 WP_004521361.1.1010 WP_004521361.1.101060 WP_004521361.1.101307 WP_004521361.1.101381 WP_004521361.1.101559 WP_004521361.1.101588 WP_004521361.1.101783 WP_004521361.1.102051 WP_004521361.1.10269 WP_004521361.1.10290 WP_004521361.1.10359 WP_004521361.1.10553 WP_004521361.1.10633 WP_004521361.1.10746 WP_004521361.1.10907 WP_004521361.1.1098 WP_004521361.1.11046 WP_004521361.1.11072 WP_004521361.1.11404 WP_004521361.1.11747 WP_004521361.1.11825 WP_004521361.1.11893 WP_004521361.1.11996 WP_004521361.1.11998 WP_004521361.1.1266 WP_004521361.1.12731 WP_004521361.1.12793 WP_004521361.1.12856 WP_004521361.1.12860 WP_004521361.1.13198 WP_004521361.1.13309 WP_004521361.1.13504 WP_004521361.1.13520 WP_004521361.1.13597 WP_004521361.1.13603 WP_004521361.1.13639 WP_004521361.1.13950 WP_004521361.1.14356 WP_004521361.1.14539 WP_004521361.1.14557 WP_004521361.1.1465 WP_004521361.1.14660 WP_004521361.1.15170 WP_004521361.1.15364 WP_004521361.1.15525 WP_004521361.1.15673 WP_004521361.1.15696 WP_004521361.1.16090 WP_004521361.1.16113 WP_004521361.1.16249 WP_004521361.1.16358 WP_004521361.1.16561 WP_004521361.1.16625 WP_004521361.1.16680 WP_004521361.1.16689 WP_004521361.1.16749 WP_004521361.1.17067 WP_004521361.1.17068 WP_004521361.1.17278 WP_004521361.1.17473 WP_004521361.1.17748 WP_004521361.1.17786 WP_004521361.1.18058 WP_004521361.1.18396 WP_004521361.1.18405 WP_004521361.1.18471 WP_004521361.1.18549 WP_004521361.1.18669 WP_004521361.1.18704 WP_004521361.1.18744 WP_004521361.1.18868 WP_004521361.1.18906 WP_004521361.1.19401 WP_004521361.1.19486 WP_004521361.1.19540 WP_004521361.1.19629 WP_004521361.1.1976 WP_004521361.1.19815 WP_004521361.1.19842 WP_004521361.1.19854 WP_004521361.1.20021 WP_004521361.1.20246 WP_004521361.1.20501 WP_004521361.1.20520 WP_004521361.1.20673 WP_004521361.1.20954 WP_004521361.1.21147 WP_004521361.1.21205 WP_004521361.1.21291 WP_004521361.1.21304 WP_004521361.1.21409 WP_004521361.1.21461 WP_004521361.1.21653 WP_004521361.1.21809 WP_004521361.1.21907 WP_004521361.1.22046 WP_004521361.1.22299 WP_004521361.1.22308 WP_004521361.1.2261 WP_004521361.1.22779 WP_004521361.1.23009 WP_004521361.1.23086 WP_004521361.1.23104 WP_004521361.1.23131 WP_004521361.1.2317 WP_004521361.1.23743 WP_004521361.1.23852 WP_004521361.1.23994 WP_004521361.1.2404 WP_004521361.1.24134 WP_004521361.1.24314 WP_004521361.1.24454 WP_004521361.1.2462 WP_004521361.1.24701 WP_004521361.1.25068 WP_004521361.1.25138 WP_004521361.1.25265 WP_004521361.1.25412 WP_004521361.1.25628 WP_004521361.1.25728 WP_004521361.1.259 WP_004521361.1.26054 WP_004521361.1.26502 WP_004521361.1.26535 WP_004521361.1.26633 WP_004521361.1.26645 WP_004521361.1.267 WP_004521361.1.26838 WP_004521361.1.26849 WP_004521361.1.27064 WP_004521361.1.27069 WP_004521361.1.27146 WP_004521361.1.27363 WP_004521361.1.27390 WP_004521361.1.27399 WP_004521361.1.27420 WP_004521361.1.27441 WP_004521361.1.27597 WP_004521361.1.2767 WP_004521361.1.27909 WP_004521361.1.28018 WP_004521361.1.28066 WP_004521361.1.28187 WP_004521361.1.28594 WP_004521361.1.28619 WP_004521361.1.28632 WP_004521361.1.29161 WP_004521361.1.29178 WP_004521361.1.29335 WP_004521361.1.29405 WP_004521361.1.29508 WP_004521361.1.29520 WP_004521361.1.29547 WP_004521361.1.29658 WP_004521361.1.29853 WP_004521361.1.29878 WP_004521361.1.29887 WP_004521361.1.29899 WP_004521361.1.29948 WP_004521361.1.30311 WP_004521361.1.30382 WP_004521361.1.3041 WP_004521361.1.30671 WP_004521361.1.3069 WP_004521361.1.30729 WP_004521361.1.30937 WP_004521361.1.30966 WP_004521361.1.31343 WP_004521361.1.31723 WP_004521361.1.32174 WP_004521361.1.32182 WP_004521361.1.32221 WP_004521361.1.324 WP_004521361.1.32581 WP_004521361.1.3273 WP_004521361.1.32951 WP_004521361.1.33077 WP_004521361.1.33087 WP_004521361.1.33130 WP_004521361.1.33157 WP_004521361.1.33158 WP_004521361.1.33165 WP_004521361.1.332 WP_004521361.1.33366 WP_004521361.1.33493 WP_004521361.1.33573 WP_004521361.1.33779 WP_004521361.1.34230 WP_004521361.1.34333 WP_004521361.1.34393 WP_004521361.1.34564 WP_004521361.1.35025 WP_004521361.1.35052 WP_004521361.1.35090 WP_004521361.1.35141 WP_004521361.1.35227 WP_004521361.1.35249 WP_004521361.1.35474 WP_004521361.1.35485 WP_004521361.1.35491 WP_004521361.1.35825 WP_004521361.1.36106 WP_004521361.1.36174 WP_004521361.1.36259 WP_004521361.1.36527 WP_004521361.1.366 WP_004521361.1.36666 WP_004521361.1.36944 WP_004521361.1.37 WP_004521361.1.3706 WP_004521361.1.37373 WP_004521361.1.37428 WP_004521361.1.37446 WP_004521361.1.37519 WP_004521361.1.37581 WP_004521361.1.37622 WP_004521361.1.37627 WP_004521361.1.37690 WP_004521361.1.37702 WP_004521361.1.37725 WP_004521361.1.37806 WP_004521361.1.37934 WP_004521361.1.37959 WP_004521361.1.38115 WP_004521361.1.38442 WP_004521361.1.38490 WP_004521361.1.38683 WP_004521361.1.3872 WP_004521361.1.38810 WP_004521361.1.39078 WP_004521361.1.39162 WP_004521361.1.39179 WP_004521361.1.3947 WP_004521361.1.39595 WP_004521361.1.39757 WP_004521361.1.39898 WP_004521361.1.40021 WP_004521361.1.40045 WP_004521361.1.40235 WP_004521361.1.40275 WP_004521361.1.40388 WP_004521361.1.40390 WP_004521361.1.40426 WP_004521361.1.4077 WP_004521361.1.41588 WP_004521361.1.41945 WP_004521361.1.42408 WP_004521361.1.42492 WP_004521361.1.42800 WP_004521361.1.43136 WP_004521361.1.43156 WP_004521361.1.43373 WP_004521361.1.43542 WP_004521361.1.43581 WP_004521361.1.43587 WP_004521361.1.43678 WP_004521361.1.43727 WP_004521361.1.43786 WP_004521361.1.44179 WP_004521361.1.44234 WP_004521361.1.44352 WP_004521361.1.44414 WP_004521361.1.44824 WP_004521361.1.45284 WP_004521361.1.45348 WP_004521361.1.45356 WP_004521361.1.45537 WP_004521361.1.45715 WP_004521361.1.45890 WP_004521361.1.4631 WP_004521361.1.46575 WP_004521361.1.46757 WP_004521361.1.46829 WP_004521361.1.4693 WP_004521361.1.46969 WP_004521361.1.47086 WP_004521361.1.47149 WP_004521361.1.4718 WP_004521361.1.47564 WP_004521361.1.48093 WP_004521361.1.48165 WP_004521361.1.48464 WP_004521361.1.49026 WP_004521361.1.49717 WP_004521361.1.49872 WP_004521361.1.50174 WP_004521361.1.50320 WP_004521361.1.50336 WP_004521361.1.50401 WP_004521361.1.50788 WP_004521361.1.50839 WP_004521361.1.5105 WP_004521361.1.51606 WP_004521361.1.51666 WP_004521361.1.5173 WP_004521361.1.5182 WP_004521361.1.51874 WP_004521361.1.51891 WP_004521361.1.51902 WP_004521361.1.52229 WP_004521361.1.52365 WP_004521361.1.52407 WP_004521361.1.52451 WP_004521361.1.52521 WP_004521361.1.52547 WP_004521361.1.52643 WP_004521361.1.52655 WP_004521361.1.52731 WP_004521361.1.52760 WP_004521361.1.52882 WP_004521361.1.5292 WP_004521361.1.53034 WP_004521361.1.53048 WP_004521361.1.53132 WP_004521361.1.53282 WP_004521361.1.53386 WP_004521361.1.53506 WP_004521361.1.53578 WP_004521361.1.54016 WP_004521361.1.5413 WP_004521361.1.54312 WP_004521361.1.54369 WP_004521361.1.54804 WP_004521361.1.54859 WP_004521361.1.55038 WP_004521361.1.55415 WP_004521361.1.55691 WP_004521361.1.55755 WP_004521361.1.55974 WP_004521361.1.55996 WP_004521361.1.5608 WP_004521361.1.56248 WP_004521361.1.5641 WP_004521361.1.56451 WP_004521361.1.56458 WP_004521361.1.56591 WP_004521361.1.56744 WP_004521361.1.56949 WP_004521361.1.56993 WP_004521361.1.57046 WP_004521361.1.57096 WP_004521361.1.57247 WP_004521361.1.5734 WP_004521361.1.57341 WP_004521361.1.57359 WP_004521361.1.5776 WP_004521361.1.58003 WP_004521361.1.58105 WP_004521361.1.58190 WP_004521361.1.58355 WP_004521361.1.58362 WP_004521361.1.58390 WP_004521361.1.58405 WP_004521361.1.58509 WP_004521361.1.58523 WP_004521361.1.58578 WP_004521361.1.58639 WP_004521361.1.58758 WP_004521361.1.5883 WP_004521361.1.59103 WP_004521361.1.59200 WP_004521361.1.59255 WP_004521361.1.59422 WP_004521361.1.59496 WP_004521361.1.59519 WP_004521361.1.59536 WP_004521361.1.59549 WP_004521361.1.59747 WP_004521361.1.60398 WP_004521361.1.60769 WP_004521361.1.60810 WP_004521361.1.60833 WP_004521361.1.60836 WP_004521361.1.60969 WP_004521361.1.61084 WP_004521361.1.61202 WP_004521361.1.61455 WP_004521361.1.61685 WP_004521361.1.61723 WP_004521361.1.61854 WP_004521361.1.6186 WP_004521361.1.61900 WP_004521361.1.62103 WP_004521361.1.62183 WP_004521361.1.62774 WP_004521361.1.63097 WP_004521361.1.63261 WP_004521361.1.63361 WP_004521361.1.63379 WP_004521361.1.63439 WP_004521361.1.63505 WP_004521361.1.63661 WP_004521361.1.63719 WP_004521361.1.63942 WP_004521361.1.64068 WP_004521361.1.64096 WP_004521361.1.64166 WP_004521361.1.64204 WP_004521361.1.64364 WP_004521361.1.64542 WP_004521361.1.64683 WP_004521361.1.65270 WP_004521361.1.65468 WP_004521361.1.65832 WP_004521361.1.65994 WP_004521361.1.66257 WP_004521361.1.66321 WP_004521361.1.66380 WP_004521361.1.66465 WP_004521361.1.67013 WP_004521361.1.67117 WP_004521361.1.67182 WP_004521361.1.67229 WP_004521361.1.67559 WP_004521361.1.6765 WP_004521361.1.67860 WP_004521361.1.67909 WP_004521361.1.67914 WP_004521361.1.67978 WP_004521361.1.6835 WP_004521361.1.68353 WP_004521361.1.68515 WP_004521361.1.68664 WP_004521361.1.68886 WP_004521361.1.68922 WP_004521361.1.69022 WP_004521361.1.69081 WP_004521361.1.69094 WP_004521361.1.69106 WP_004521361.1.69169 WP_004521361.1.69217 WP_004521361.1.69337 WP_004521361.1.69354 WP_004521361.1.69770 WP_004521361.1.69918 WP_004521361.1.70016 WP_004521361.1.7006 WP_004521361.1.70066 WP_004521361.1.70096 WP_004521361.1.70278 WP_004521361.1.70280 WP_004521361.1.70735 WP_004521361.1.71392 WP_004521361.1.71444 WP_004521361.1.71564 WP_004521361.1.71901 WP_004521361.1.72015 WP_004521361.1.72083 WP_004521361.1.72817 WP_004521361.1.73317 WP_004521361.1.73418 WP_004521361.1.73521 WP_004521361.1.73576 WP_004521361.1.73906 WP_004521361.1.73974 WP_004521361.1.74177 WP_004521361.1.74425 WP_004521361.1.7450 WP_004521361.1.74569 WP_004521361.1.74690 WP_004521361.1.75001 WP_004521361.1.75027 WP_004521361.1.75075 WP_004521361.1.75276 WP_004521361.1.75519 WP_004521361.1.75677 WP_004521361.1.75708 WP_004521361.1.75711 WP_004521361.1.75776 WP_004521361.1.75883 WP_004521361.1.75913 WP_004521361.1.75937 WP_004521361.1.76142 WP_004521361.1.76290 WP_004521361.1.76432 WP_004521361.1.76522 WP_004521361.1.76575 WP_004521361.1.766 WP_004521361.1.7703 WP_004521361.1.77249 WP_004521361.1.77287 WP_004521361.1.77319 WP_004521361.1.77689 WP_004521361.1.77788 WP_004521361.1.77845 WP_004521361.1.78029 WP_004521361.1.78278 WP_004521361.1.78506 WP_004521361.1.78628 WP_004521361.1.78759 WP_004521361.1.78807 WP_004521361.1.78827 WP_004521361.1.79052 WP_004521361.1.79360 WP_004521361.1.795 WP_004521361.1.79689 WP_004521361.1.79710 WP_004521361.1.79725 WP_004521361.1.79782 WP_004521361.1.80098 WP_004521361.1.80302 WP_004521361.1.80395 WP_004521361.1.80433 WP_004521361.1.80614 WP_004521361.1.80923 WP_004521361.1.81042 WP_004521361.1.8126 WP_004521361.1.81479 WP_004521361.1.81511 WP_004521361.1.81543 WP_004521361.1.81665 WP_004521361.1.82197 WP_004521361.1.82323 WP_004521361.1.82394 WP_004521361.1.82506 WP_004521361.1.82575 WP_004521361.1.82694 WP_004521361.1.82727 WP_004521361.1.82915 WP_004521361.1.83080 WP_004521361.1.83357 WP_004521361.1.8341 WP_004521361.1.83487 WP_004521361.1.83543 WP_004521361.1.83567 WP_004521361.1.83609 WP_004521361.1.83688 WP_004521361.1.8388 WP_004521361.1.8390 WP_004521361.1.8395 WP_004521361.1.83967 WP_004521361.1.84002 WP_004521361.1.84026 WP_004521361.1.84181 WP_004521361.1.84375 WP_004521361.1.84379 WP_004521361.1.84654 WP_004521361.1.84866 WP_004521361.1.85170 WP_004521361.1.85412 WP_004521361.1.85443 WP_004521361.1.85467 WP_004521361.1.85490 WP_004521361.1.85565 WP_004521361.1.85584 WP_004521361.1.856 WP_004521361.1.85641 WP_004521361.1.85645 WP_004521361.1.85774 WP_004521361.1.8585 WP_004521361.1.8629 WP_004521361.1.86295 WP_004521361.1.86438 WP_004521361.1.86525 WP_004521361.1.86806 WP_004521361.1.86872 WP_004521361.1.8697 WP_004521361.1.87114 WP_004521361.1.87278 WP_004521361.1.87324 WP_004521361.1.87652 WP_004521361.1.87759 WP_004521361.1.87811 WP_004521361.1.88003 WP_004521361.1.88117 WP_004521361.1.88168 WP_004521361.1.88237 WP_004521361.1.88322 WP_004521361.1.88369 WP_004521361.1.88411 WP_004521361.1.88666 WP_004521361.1.88682 WP_004521361.1.88764 WP_004521361.1.88920 WP_004521361.1.89093 WP_004521361.1.8912 WP_004521361.1.89240 WP_004521361.1.89435 WP_004521361.1.89514 WP_004521361.1.89782 WP_004521361.1.90079 WP_004521361.1.90471 WP_004521361.1.9079 WP_004521361.1.90934 WP_004521361.1.91025 WP_004521361.1.91142 WP_004521361.1.91198 WP_004521361.1.91700 WP_004521361.1.91709 WP_004521361.1.91763 WP_004521361.1.91823 WP_004521361.1.92095 WP_004521361.1.92367 WP_004521361.1.92406 WP_004521361.1.92430 WP_004521361.1.92493 WP_004521361.1.92507 WP_004521361.1.9280 WP_004521361.1.92904 WP_004521361.1.93844 WP_004521361.1.93845 WP_004521361.1.94023 WP_004521361.1.94050 WP_004521361.1.94117 WP_004521361.1.94121 WP_004521361.1.94286 WP_004521361.1.94403 WP_004521361.1.94498 WP_004521361.1.94520 WP_004521361.1.9479 WP_004521361.1.94901 WP_004521361.1.94926 WP_004521361.1.95054 WP_004521361.1.95300 WP_004521361.1.95339 WP_004521361.1.9537 WP_004521361.1.95420 WP_004521361.1.95587 WP_004521361.1.95644 WP_004521361.1.95672 WP_004521361.1.95938 WP_004521361.1.96381 WP_004521361.1.97058 WP_004521361.1.97112 WP_004521361.1.97148 WP_004521361.1.97989 WP_004521361.1.98218 WP_004521361.1.98316 WP_004521361.1.98491 WP_004521361.1.98547 WP_004521361.1.98688 WP_004521361.1.98713 WP_004521361.1.98753 WP_004521361.1.98768 WP_004521361.1.98944 WP_004521361.1.99061 WP_004521361.1.99069 WP_004521361.1.99160 WP_004521361.1.99233 WP_004521361.1.99290 WP_004521361.1.9962 WP_004521361.1.99629 WP_004521361.1.99741 WP_004521361.1.9975 WP_004521361.1.9983 WP_004521361.1.99890 WP_004521361.1.99919 YP_108175.1.59693 gi|76811500|ref|YP_333705.1| gi|237812501|ref|YP_002896952.1| gi|53719189|ref|YP_108175.1| gi|386861578|ref|YP_006274527.1| 272560.BPSL1555 320372.BURPS1710b_2310 320373.BURPS668_2123 357348.BURPS1106A_2179 536230.GBP346_A2250 gi|526470722|ref|YP_008340283.1| gi|556574790|ref|YP_008745601.1| gi|126451951|ref|YP_001066443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]