SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126452224|ref|YP_001065375.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126452224|ref|YP_001065375.1|
Domain Number 1 Region: 1-253
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.51e-69
Family Phosphate binding protein-like 0.000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126452224|ref|YP_001065375.1|
Sequence length 258
Comment histidine ABC transporter periplasmic histidine-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MKKLALCAALALAAGGAFAKEWKTVRIGVDASYPPFESTAPSGEIVGFDVDLAKEVCKRI
NAKCTWTPQDLDGIIPALKAKKFDVIVSSLTVTDKRREQIDFSDKLYDAPARMIAKAGSP
LAPSVESLKGKRVGVEQGSTQETFAKAHWEPKGVTIVSYQNQDQVYADLGSGRLDATLQD
ELQADYGFLRTPRGKGFAWAGPAVKDPRTLGDGTAMGLRKEDADLKDAINRALASMHKDG
TYDRLSRKYFPYSVYSAK
Download sequence
Identical sequences A0A095HD07 A0A0F6GCX3 A0A0F6L604 A0A0H2WI04 A0A290Y7P2 A0A2K3G245 A3NSQ4 C4B1R9 Q63W57
gi|403517748|ref|YP_006651881.1| gi|556577466|ref|YP_008743085.1| gi|126452224|ref|YP_001065375.1| gi|53718673|ref|YP_107659.1| WP_004198602.1.100104 WP_004198602.1.100195 WP_004198602.1.100583 WP_004198602.1.100727 WP_004198602.1.100825 WP_004198602.1.100900 WP_004198602.1.101307 WP_004198602.1.101783 WP_004198602.1.10269 WP_004198602.1.10553 WP_004198602.1.10633 WP_004198602.1.10907 WP_004198602.1.11046 WP_004198602.1.11160 WP_004198602.1.11268 WP_004198602.1.11404 WP_004198602.1.11747 WP_004198602.1.11825 WP_004198602.1.11996 WP_004198602.1.1266 WP_004198602.1.12856 WP_004198602.1.13309 WP_004198602.1.13504 WP_004198602.1.13520 WP_004198602.1.13639 WP_004198602.1.13925 WP_004198602.1.1465 WP_004198602.1.15170 WP_004198602.1.15673 WP_004198602.1.16090 WP_004198602.1.16113 WP_004198602.1.16249 WP_004198602.1.16358 WP_004198602.1.16561 WP_004198602.1.16625 WP_004198602.1.16680 WP_004198602.1.16689 WP_004198602.1.17067 WP_004198602.1.17473 WP_004198602.1.17786 WP_004198602.1.18549 WP_004198602.1.18631 WP_004198602.1.18868 WP_004198602.1.19486 WP_004198602.1.19629 WP_004198602.1.1976 WP_004198602.1.20531 WP_004198602.1.20673 WP_004198602.1.21304 WP_004198602.1.21442 WP_004198602.1.21653 WP_004198602.1.21809 WP_004198602.1.22299 WP_004198602.1.22308 WP_004198602.1.22329 WP_004198602.1.2261 WP_004198602.1.22625 WP_004198602.1.23086 WP_004198602.1.23104 WP_004198602.1.23385 WP_004198602.1.23743 WP_004198602.1.23852 WP_004198602.1.24020 WP_004198602.1.2404 WP_004198602.1.24134 WP_004198602.1.24454 WP_004198602.1.24513 WP_004198602.1.25412 WP_004198602.1.25628 WP_004198602.1.26054 WP_004198602.1.26445 WP_004198602.1.26535 WP_004198602.1.26565 WP_004198602.1.26633 WP_004198602.1.26645 WP_004198602.1.26838 WP_004198602.1.27069 WP_004198602.1.27146 WP_004198602.1.27363 WP_004198602.1.27390 WP_004198602.1.27810 WP_004198602.1.27909 WP_004198602.1.28187 WP_004198602.1.28453 WP_004198602.1.28594 WP_004198602.1.28619 WP_004198602.1.29148 WP_004198602.1.29335 WP_004198602.1.29405 WP_004198602.1.29520 WP_004198602.1.29853 WP_004198602.1.29878 WP_004198602.1.29887 WP_004198602.1.29948 WP_004198602.1.30311 WP_004198602.1.30382 WP_004198602.1.3069 WP_004198602.1.30729 WP_004198602.1.30937 WP_004198602.1.31343 WP_004198602.1.31723 WP_004198602.1.31831 WP_004198602.1.32221 WP_004198602.1.324 WP_004198602.1.3251 WP_004198602.1.32951 WP_004198602.1.33130 WP_004198602.1.33157 WP_004198602.1.33158 WP_004198602.1.33419 WP_004198602.1.34230 WP_004198602.1.34564 WP_004198602.1.34747 WP_004198602.1.35052 WP_004198602.1.35227 WP_004198602.1.35249 WP_004198602.1.35757 WP_004198602.1.35825 WP_004198602.1.35878 WP_004198602.1.36527 WP_004198602.1.36662 WP_004198602.1.36666 WP_004198602.1.36944 WP_004198602.1.37 WP_004198602.1.37517 WP_004198602.1.37535 WP_004198602.1.37690 WP_004198602.1.37934 WP_004198602.1.37994 WP_004198602.1.38115 WP_004198602.1.38490 WP_004198602.1.38683 WP_004198602.1.3872 WP_004198602.1.38810 WP_004198602.1.38946 WP_004198602.1.39162 WP_004198602.1.39179 WP_004198602.1.39349 WP_004198602.1.3947 WP_004198602.1.39757 WP_004198602.1.39898 WP_004198602.1.40235 WP_004198602.1.40390 WP_004198602.1.40426 WP_004198602.1.40448 WP_004198602.1.4077 WP_004198602.1.41477 WP_004198602.1.41945 WP_004198602.1.42408 WP_004198602.1.42496 WP_004198602.1.42800 WP_004198602.1.43136 WP_004198602.1.43542 WP_004198602.1.43678 WP_004198602.1.43727 WP_004198602.1.43786 WP_004198602.1.43899 WP_004198602.1.44179 WP_004198602.1.44234 WP_004198602.1.44352 WP_004198602.1.44540 WP_004198602.1.45348 WP_004198602.1.46575 WP_004198602.1.46757 WP_004198602.1.46829 WP_004198602.1.4693 WP_004198602.1.47149 WP_004198602.1.4718 WP_004198602.1.47564 WP_004198602.1.4810 WP_004198602.1.48313 WP_004198602.1.48407 WP_004198602.1.48464 WP_004198602.1.50336 WP_004198602.1.50636 WP_004198602.1.50788 WP_004198602.1.50839 WP_004198602.1.5105 WP_004198602.1.51666 WP_004198602.1.5182 WP_004198602.1.51874 WP_004198602.1.51891 WP_004198602.1.51902 WP_004198602.1.52229 WP_004198602.1.52365 WP_004198602.1.52407 WP_004198602.1.52451 WP_004198602.1.52547 WP_004198602.1.52643 WP_004198602.1.52655 WP_004198602.1.53048 WP_004198602.1.53103 WP_004198602.1.5338 WP_004198602.1.53506 WP_004198602.1.53977 WP_004198602.1.54016 WP_004198602.1.54312 WP_004198602.1.54804 WP_004198602.1.54859 WP_004198602.1.54892 WP_004198602.1.55038 WP_004198602.1.55996 WP_004198602.1.5608 WP_004198602.1.56451 WP_004198602.1.56744 WP_004198602.1.56949 WP_004198602.1.56993 WP_004198602.1.57046 WP_004198602.1.57096 WP_004198602.1.57247 WP_004198602.1.57359 WP_004198602.1.57679 WP_004198602.1.5776 WP_004198602.1.58190 WP_004198602.1.58362 WP_004198602.1.58509 WP_004198602.1.58523 WP_004198602.1.58578 WP_004198602.1.58639 WP_004198602.1.58758 WP_004198602.1.5883 WP_004198602.1.59255 WP_004198602.1.59422 WP_004198602.1.59496 WP_004198602.1.59549 WP_004198602.1.60398 WP_004198602.1.60810 WP_004198602.1.60833 WP_004198602.1.60836 WP_004198602.1.61073 WP_004198602.1.61084 WP_004198602.1.61455 WP_004198602.1.61588 WP_004198602.1.61685 WP_004198602.1.62183 WP_004198602.1.63097 WP_004198602.1.63379 WP_004198602.1.63505 WP_004198602.1.63719 WP_004198602.1.64068 WP_004198602.1.64096 WP_004198602.1.64166 WP_004198602.1.64383 WP_004198602.1.64542 WP_004198602.1.65093 WP_004198602.1.65270 WP_004198602.1.65832 WP_004198602.1.66380 WP_004198602.1.66594 WP_004198602.1.67182 WP_004198602.1.67229 WP_004198602.1.67393 WP_004198602.1.67860 WP_004198602.1.67914 WP_004198602.1.68886 WP_004198602.1.69094 WP_004198602.1.69217 WP_004198602.1.69337 WP_004198602.1.69354 WP_004198602.1.69508 WP_004198602.1.70016 WP_004198602.1.70278 WP_004198602.1.71392 WP_004198602.1.71901 WP_004198602.1.72015 WP_004198602.1.72083 WP_004198602.1.72545 WP_004198602.1.72798 WP_004198602.1.72817 WP_004198602.1.73317 WP_004198602.1.73521 WP_004198602.1.73906 WP_004198602.1.73974 WP_004198602.1.7450 WP_004198602.1.74675 WP_004198602.1.75001 WP_004198602.1.75027 WP_004198602.1.75075 WP_004198602.1.75230 WP_004198602.1.75276 WP_004198602.1.75708 WP_004198602.1.75711 WP_004198602.1.75776 WP_004198602.1.75861 WP_004198602.1.76142 WP_004198602.1.766 WP_004198602.1.7703 WP_004198602.1.77287 WP_004198602.1.77689 WP_004198602.1.77845 WP_004198602.1.78278 WP_004198602.1.78506 WP_004198602.1.78557 WP_004198602.1.78759 WP_004198602.1.78827 WP_004198602.1.79360 WP_004198602.1.795 WP_004198602.1.79653 WP_004198602.1.79689 WP_004198602.1.79725 WP_004198602.1.79782 WP_004198602.1.80098 WP_004198602.1.80395 WP_004198602.1.80433 WP_004198602.1.80614 WP_004198602.1.8126 WP_004198602.1.81543 WP_004198602.1.82197 WP_004198602.1.82283 WP_004198602.1.82323 WP_004198602.1.82394 WP_004198602.1.82506 WP_004198602.1.82915 WP_004198602.1.82950 WP_004198602.1.83357 WP_004198602.1.83543 WP_004198602.1.83688 WP_004198602.1.8390 WP_004198602.1.83967 WP_004198602.1.84026 WP_004198602.1.84063 WP_004198602.1.84181 WP_004198602.1.84375 WP_004198602.1.84654 WP_004198602.1.85170 WP_004198602.1.85412 WP_004198602.1.85584 WP_004198602.1.85645 WP_004198602.1.8585 WP_004198602.1.86525 WP_004198602.1.8697 WP_004198602.1.87278 WP_004198602.1.87811 WP_004198602.1.88003 WP_004198602.1.88117 WP_004198602.1.88237 WP_004198602.1.88322 WP_004198602.1.88682 WP_004198602.1.88920 WP_004198602.1.8912 WP_004198602.1.89514 WP_004198602.1.90079 WP_004198602.1.9079 WP_004198602.1.91025 WP_004198602.1.91142 WP_004198602.1.91763 WP_004198602.1.91823 WP_004198602.1.92095 WP_004198602.1.9236 WP_004198602.1.92367 WP_004198602.1.92493 WP_004198602.1.9281 WP_004198602.1.94023 WP_004198602.1.94121 WP_004198602.1.94286 WP_004198602.1.94403 WP_004198602.1.94498 WP_004198602.1.94520 WP_004198602.1.95054 WP_004198602.1.95339 WP_004198602.1.95420 WP_004198602.1.95672 WP_004198602.1.95952 WP_004198602.1.96381 WP_004198602.1.96660 WP_004198602.1.98066 WP_004198602.1.98491 WP_004198602.1.98547 WP_004198602.1.98688 WP_004198602.1.98713 WP_004198602.1.98768 WP_004198602.1.98944 WP_004198602.1.99061 WP_004198602.1.99233 WP_004198602.1.9962 WP_004198602.1.99741 WP_004198602.1.9975 WP_004198602.1.99890 WP_004198602.1.99919 YP_102514.1.87047 YP_107659.1.59693 gi|53725151|ref|YP_102514.1| gi|121601374|ref|YP_992328.1| gi|126448544|ref|YP_001081123.1| 243160.BMA0747 272560.BPSL1033 320388.BMASAVP1_A0988 320389.BMA10247_1579 357348.BURPS1106A_1095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]