SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126452231|ref|YP_001067668.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126452231|ref|YP_001067668.1|
Domain Number 1 Region: 38-300
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.44e-64
Family Phosphate binding protein-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126452231|ref|YP_001067668.1|
Sequence length 328
Comment glutamate/aspartate ABC transporter, periplasmic glutamate/aspartate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MPPGKSVVNNHYFHKNYFAKLARVFAKEMTTMKFPKAMLMVAALSTFAGGAIAQETGTLK
KIKDTGVIALGHRESSIPFSYYDQNQQVVGYSRDFQMKVVDAVKKKLNLPNLQVKNIPVT
SQNRIPLVQNGTVDIECGSTTNNLDRQKQAAFSDTIFVIGTRLMTKKDSGIKDFADLKGK
TVVTTAGTTSERLLREMNNKNQMGMSIISAKDHGESFQTLETGRAVAFMMDDALLAGERA
KAKQPGEWVIVGKPQSQEAYGCMMRKDDPAFKKVVDDAIVQVEKSGEAAKIYSKWFENPI
PPKGLNLNFPLSDEMKKLYANPNDKALD
Download sequence
Identical sequences A0A0E1SC18 A0A0E1U0Z6 A0A0E1UJE8 A3NDI6 A3NZ97 A8EIB3 C4KV58
gi|237813798|ref|YP_002898249.1| gi|126452231|ref|YP_001067668.1| gi|126439062|ref|YP_001060407.1| 320373.BURPS668_3396 357348.BURPS1106A_3431 536230.GBP346_A3576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]