SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126452444|ref|YP_001066260.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126452444|ref|YP_001066260.1|
Domain Number 1 Region: 33-311
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.97e-55
Family Phosphate binding protein-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126452444|ref|YP_001066260.1|
Sequence length 312
Comment amine ABC transporter periplasmic amine-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MKVPRFSRTLRAAAAALAVSLCAAAPGARAAGAVTVASKIDTEGNLLGNVISQVLKAHGI
AVVDKIGLGATPIVRRALTTGEIDIYPEYTGNAAFFFNKADDPAWKNAAQGYALARQLDY
AANRIVWLAPAPANNTWGVAVLNSIAQARHLKTFSDFGKWVAAGGKVKLAASAEFVNSAS
ALPSFEKAYGFKLKPEQMLVLSGGDTAATIKAAAQQTDGVNAAMVYGTDGGIAATGLAVL
DDDKHVQPVYAPTPIIREAVLNAHPQIADYLKPVFASLDLKTLQALNARIQINGEPAAGV
AASYLKAKGFVK
Download sequence
Identical sequences A0A069B557 A0A0E1SJ62 A0A0E1TWY9 A0A0E1UR50 A0A0E1W3V3 A0A0F6GCT1 A0A0H2WDH9 A0A0H3HQ81 A0A290Y8L2 A0A2K3FH94 A0A2K3GI12 A0A2K3HNN9 A0A2K3IE86 A2S2S0 A3NV89 B1HJ28 C4AZJ4 C4KY20 Q3JSC4
gi|386861767|ref|YP_006274716.1| gi|556576513|ref|YP_008745768.1| gi|126452444|ref|YP_001066260.1| 243160.BMA1138 320372.BURPS1710b_2134 320388.BMASAVP1_A1578 320389.BMA10247_0922 357348.BURPS1106A_1995 412022.BMA10229_A0237 536230.GBP346_A2021 gi|126449267|ref|YP_001080485.1| gi|121600863|ref|YP_992904.1| gi|403518693|ref|YP_006652826.1| gi|526472013|ref|YP_008340438.1| gi|76809480|ref|YP_333529.1| gi|237812273|ref|YP_002896724.1| gi|124385402|ref|YP_001026239.1| WP_004193670.1.100104 WP_004193670.1.100195 WP_004193670.1.10047 WP_004193670.1.100583 WP_004193670.1.100720 WP_004193670.1.100727 WP_004193670.1.100825 WP_004193670.1.1010 WP_004193670.1.101381 WP_004193670.1.101559 WP_004193670.1.101588 WP_004193670.1.101783 WP_004193670.1.102051 WP_004193670.1.10269 WP_004193670.1.10290 WP_004193670.1.10359 WP_004193670.1.10907 WP_004193670.1.1098 WP_004193670.1.11046 WP_004193670.1.11072 WP_004193670.1.11160 WP_004193670.1.11268 WP_004193670.1.11825 WP_004193670.1.11893 WP_004193670.1.11996 WP_004193670.1.12731 WP_004193670.1.12793 WP_004193670.1.12856 WP_004193670.1.12860 WP_004193670.1.13198 WP_004193670.1.13309 WP_004193670.1.13504 WP_004193670.1.13597 WP_004193670.1.13603 WP_004193670.1.13639 WP_004193670.1.13925 WP_004193670.1.13950 WP_004193670.1.14356 WP_004193670.1.14539 WP_004193670.1.14557 WP_004193670.1.1465 WP_004193670.1.14660 WP_004193670.1.15170 WP_004193670.1.15364 WP_004193670.1.15525 WP_004193670.1.15673 WP_004193670.1.16113 WP_004193670.1.16249 WP_004193670.1.16358 WP_004193670.1.16540 WP_004193670.1.16625 WP_004193670.1.16689 WP_004193670.1.16749 WP_004193670.1.17068 WP_004193670.1.17278 WP_004193670.1.17473 WP_004193670.1.17748 WP_004193670.1.17786 WP_004193670.1.18058 WP_004193670.1.18396 WP_004193670.1.18405 WP_004193670.1.18471 WP_004193670.1.18549 WP_004193670.1.18631 WP_004193670.1.18669 WP_004193670.1.18704 WP_004193670.1.18744 WP_004193670.1.18906 WP_004193670.1.19401 WP_004193670.1.19540 WP_004193670.1.19629 WP_004193670.1.19815 WP_004193670.1.19854 WP_004193670.1.20021 WP_004193670.1.20246 WP_004193670.1.20520 WP_004193670.1.20531 WP_004193670.1.21147 WP_004193670.1.21205 WP_004193670.1.21291 WP_004193670.1.21409 WP_004193670.1.21442 WP_004193670.1.21461 WP_004193670.1.21809 WP_004193670.1.22046 WP_004193670.1.22299 WP_004193670.1.22329 WP_004193670.1.22625 WP_004193670.1.22779 WP_004193670.1.23086 WP_004193670.1.23385 WP_004193670.1.23743 WP_004193670.1.23852 WP_004193670.1.23994 WP_004193670.1.24020 WP_004193670.1.2404 WP_004193670.1.24134 WP_004193670.1.24314 WP_004193670.1.24372 WP_004193670.1.24513 WP_004193670.1.2462 WP_004193670.1.24701 WP_004193670.1.25068 WP_004193670.1.25102 WP_004193670.1.25138 WP_004193670.1.25265 WP_004193670.1.25412 WP_004193670.1.25628 WP_004193670.1.25728 WP_004193670.1.259 WP_004193670.1.26054 WP_004193670.1.26445 WP_004193670.1.26502 WP_004193670.1.26565 WP_004193670.1.26633 WP_004193670.1.267 WP_004193670.1.26849 WP_004193670.1.27064 WP_004193670.1.27069 WP_004193670.1.27146 WP_004193670.1.27363 WP_004193670.1.27390 WP_004193670.1.27399 WP_004193670.1.27441 WP_004193670.1.27597 WP_004193670.1.27810 WP_004193670.1.27909 WP_004193670.1.28018 WP_004193670.1.28453 WP_004193670.1.28619 WP_004193670.1.28632 WP_004193670.1.29148 WP_004193670.1.29161 WP_004193670.1.29335 WP_004193670.1.29405 WP_004193670.1.29508 WP_004193670.1.29547 WP_004193670.1.29658 WP_004193670.1.29853 WP_004193670.1.29887 WP_004193670.1.29899 WP_004193670.1.29948 WP_004193670.1.3041 WP_004193670.1.30671 WP_004193670.1.30937 WP_004193670.1.30966 WP_004193670.1.31343 WP_004193670.1.31723 WP_004193670.1.31831 WP_004193670.1.32174 WP_004193670.1.32182 WP_004193670.1.324 WP_004193670.1.3251 WP_004193670.1.3273 WP_004193670.1.33077 WP_004193670.1.33087 WP_004193670.1.33130 WP_004193670.1.33157 WP_004193670.1.33158 WP_004193670.1.33165 WP_004193670.1.332 WP_004193670.1.33366 WP_004193670.1.33419 WP_004193670.1.33493 WP_004193670.1.33543 WP_004193670.1.33573 WP_004193670.1.33779 WP_004193670.1.34230 WP_004193670.1.34393 WP_004193670.1.34564 WP_004193670.1.34747 WP_004193670.1.35025 WP_004193670.1.35052 WP_004193670.1.35090 WP_004193670.1.35141 WP_004193670.1.35249 WP_004193670.1.35474 WP_004193670.1.35485 WP_004193670.1.35491 WP_004193670.1.35757 WP_004193670.1.35878 WP_004193670.1.36106 WP_004193670.1.36259 WP_004193670.1.366 WP_004193670.1.36662 WP_004193670.1.36666 WP_004193670.1.36944 WP_004193670.1.37 WP_004193670.1.3706 WP_004193670.1.37428 WP_004193670.1.37446 WP_004193670.1.37519 WP_004193670.1.37535 WP_004193670.1.37581 WP_004193670.1.37622 WP_004193670.1.37690 WP_004193670.1.37725 WP_004193670.1.37806 WP_004193670.1.37934 WP_004193670.1.37959 WP_004193670.1.37994 WP_004193670.1.38442 WP_004193670.1.38490 WP_004193670.1.38683 WP_004193670.1.3872 WP_004193670.1.38810 WP_004193670.1.38946 WP_004193670.1.39078 WP_004193670.1.39162 WP_004193670.1.39179 WP_004193670.1.39349 WP_004193670.1.3947 WP_004193670.1.39595 WP_004193670.1.39757 WP_004193670.1.39898 WP_004193670.1.40045 WP_004193670.1.40191 WP_004193670.1.40235 WP_004193670.1.40275 WP_004193670.1.40388 WP_004193670.1.40448 WP_004193670.1.4077 WP_004193670.1.41477 WP_004193670.1.41945 WP_004193670.1.42408 WP_004193670.1.43136 WP_004193670.1.43156 WP_004193670.1.43373 WP_004193670.1.43581 WP_004193670.1.43587 WP_004193670.1.43678 WP_004193670.1.43727 WP_004193670.1.43786 WP_004193670.1.43899 WP_004193670.1.44179 WP_004193670.1.44414 WP_004193670.1.44540 WP_004193670.1.44824 WP_004193670.1.45284 WP_004193670.1.45348 WP_004193670.1.45537 WP_004193670.1.45715 WP_004193670.1.45890 WP_004193670.1.4631 WP_004193670.1.46575 WP_004193670.1.46757 WP_004193670.1.46829 WP_004193670.1.46969 WP_004193670.1.47086 WP_004193670.1.48093 WP_004193670.1.4810 WP_004193670.1.48165 WP_004193670.1.48313 WP_004193670.1.48407 WP_004193670.1.48464 WP_004193670.1.49717 WP_004193670.1.49872 WP_004193670.1.50174 WP_004193670.1.50336 WP_004193670.1.50401 WP_004193670.1.50636 WP_004193670.1.5105 WP_004193670.1.51606 WP_004193670.1.5182 WP_004193670.1.52229 WP_004193670.1.52407 WP_004193670.1.52451 WP_004193670.1.52521 WP_004193670.1.52547 WP_004193670.1.52643 WP_004193670.1.52655 WP_004193670.1.52731 WP_004193670.1.52760 WP_004193670.1.53034 WP_004193670.1.53048 WP_004193670.1.53103 WP_004193670.1.53132 WP_004193670.1.53282 WP_004193670.1.5338 WP_004193670.1.53386 WP_004193670.1.53506 WP_004193670.1.53578 WP_004193670.1.53977 WP_004193670.1.54016 WP_004193670.1.54312 WP_004193670.1.54859 WP_004193670.1.54892 WP_004193670.1.55038 WP_004193670.1.55415 WP_004193670.1.55691 WP_004193670.1.55755 WP_004193670.1.55996 WP_004193670.1.5608 WP_004193670.1.56248 WP_004193670.1.5641 WP_004193670.1.56451 WP_004193670.1.56458 WP_004193670.1.56744 WP_004193670.1.56993 WP_004193670.1.57046 WP_004193670.1.57096 WP_004193670.1.57247 WP_004193670.1.5734 WP_004193670.1.57341 WP_004193670.1.57679 WP_004193670.1.5776 WP_004193670.1.58003 WP_004193670.1.58105 WP_004193670.1.58190 WP_004193670.1.58355 WP_004193670.1.58390 WP_004193670.1.58405 WP_004193670.1.58509 WP_004193670.1.58578 WP_004193670.1.59200 WP_004193670.1.59255 WP_004193670.1.59422 WP_004193670.1.59519 WP_004193670.1.59747 WP_004193670.1.60398 WP_004193670.1.60769 WP_004193670.1.60810 WP_004193670.1.60833 WP_004193670.1.61073 WP_004193670.1.61084 WP_004193670.1.61202 WP_004193670.1.61588 WP_004193670.1.61685 WP_004193670.1.61723 WP_004193670.1.61854 WP_004193670.1.6186 WP_004193670.1.61900 WP_004193670.1.62103 WP_004193670.1.62774 WP_004193670.1.63097 WP_004193670.1.63261 WP_004193670.1.63361 WP_004193670.1.63379 WP_004193670.1.63439 WP_004193670.1.63505 WP_004193670.1.63661 WP_004193670.1.63719 WP_004193670.1.63942 WP_004193670.1.64068 WP_004193670.1.64096 WP_004193670.1.64364 WP_004193670.1.64542 WP_004193670.1.64892 WP_004193670.1.65093 WP_004193670.1.65270 WP_004193670.1.65468 WP_004193670.1.65832 WP_004193670.1.65994 WP_004193670.1.66257 WP_004193670.1.66321 WP_004193670.1.66465 WP_004193670.1.66594 WP_004193670.1.67117 WP_004193670.1.67182 WP_004193670.1.67393 WP_004193670.1.67559 WP_004193670.1.6765 WP_004193670.1.67860 WP_004193670.1.67909 WP_004193670.1.67978 WP_004193670.1.6835 WP_004193670.1.68515 WP_004193670.1.68664 WP_004193670.1.68922 WP_004193670.1.69022 WP_004193670.1.69094 WP_004193670.1.69106 WP_004193670.1.69217 WP_004193670.1.69354 WP_004193670.1.69508 WP_004193670.1.69770 WP_004193670.1.70016 WP_004193670.1.7006 WP_004193670.1.70066 WP_004193670.1.70096 WP_004193670.1.70278 WP_004193670.1.70280 WP_004193670.1.70735 WP_004193670.1.71392 WP_004193670.1.71444 WP_004193670.1.71564 WP_004193670.1.71901 WP_004193670.1.72015 WP_004193670.1.72083 WP_004193670.1.72545 WP_004193670.1.72798 WP_004193670.1.72817 WP_004193670.1.73317 WP_004193670.1.73418 WP_004193670.1.73576 WP_004193670.1.73906 WP_004193670.1.73974 WP_004193670.1.74177 WP_004193670.1.74425 WP_004193670.1.7450 WP_004193670.1.74569 WP_004193670.1.74675 WP_004193670.1.74690 WP_004193670.1.75001 WP_004193670.1.75027 WP_004193670.1.75230 WP_004193670.1.75677 WP_004193670.1.75711 WP_004193670.1.75776 WP_004193670.1.75861 WP_004193670.1.75883 WP_004193670.1.75913 WP_004193670.1.75937 WP_004193670.1.76142 WP_004193670.1.76290 WP_004193670.1.76522 WP_004193670.1.76575 WP_004193670.1.766 WP_004193670.1.7703 WP_004193670.1.77249 WP_004193670.1.77319 WP_004193670.1.77689 WP_004193670.1.77788 WP_004193670.1.78029 WP_004193670.1.78278 WP_004193670.1.78506 WP_004193670.1.78557 WP_004193670.1.78628 WP_004193670.1.78807 WP_004193670.1.78827 WP_004193670.1.79052 WP_004193670.1.79360 WP_004193670.1.79653 WP_004193670.1.79710 WP_004193670.1.80302 WP_004193670.1.80433 WP_004193670.1.80923 WP_004193670.1.81042 WP_004193670.1.8126 WP_004193670.1.81479 WP_004193670.1.81511 WP_004193670.1.82197 WP_004193670.1.82283 WP_004193670.1.82323 WP_004193670.1.82394 WP_004193670.1.82506 WP_004193670.1.82575 WP_004193670.1.82694 WP_004193670.1.82727 WP_004193670.1.83080 WP_004193670.1.83357 WP_004193670.1.8341 WP_004193670.1.83487 WP_004193670.1.83543 WP_004193670.1.83567 WP_004193670.1.83609 WP_004193670.1.83688 WP_004193670.1.8388 WP_004193670.1.8390 WP_004193670.1.8395 WP_004193670.1.83967 WP_004193670.1.84002 WP_004193670.1.84026 WP_004193670.1.84181 WP_004193670.1.84375 WP_004193670.1.84379 WP_004193670.1.84480 WP_004193670.1.84866 WP_004193670.1.85170 WP_004193670.1.85412 WP_004193670.1.85443 WP_004193670.1.85467 WP_004193670.1.85565 WP_004193670.1.85584 WP_004193670.1.856 WP_004193670.1.85641 WP_004193670.1.85774 WP_004193670.1.8585 WP_004193670.1.8629 WP_004193670.1.86295 WP_004193670.1.86438 WP_004193670.1.86525 WP_004193670.1.86806 WP_004193670.1.86872 WP_004193670.1.8697 WP_004193670.1.87114 WP_004193670.1.87278 WP_004193670.1.87324 WP_004193670.1.87652 WP_004193670.1.87759 WP_004193670.1.87811 WP_004193670.1.88003 WP_004193670.1.88237 WP_004193670.1.88369 WP_004193670.1.88666 WP_004193670.1.88682 WP_004193670.1.88764 WP_004193670.1.89093 WP_004193670.1.89240 WP_004193670.1.89435 WP_004193670.1.89782 WP_004193670.1.90471 WP_004193670.1.90934 WP_004193670.1.91025 WP_004193670.1.91142 WP_004193670.1.91198 WP_004193670.1.91700 WP_004193670.1.91763 WP_004193670.1.92367 WP_004193670.1.92406 WP_004193670.1.92430 WP_004193670.1.92493 WP_004193670.1.9280 WP_004193670.1.9281 WP_004193670.1.92904 WP_004193670.1.94117 WP_004193670.1.94286 WP_004193670.1.94498 WP_004193670.1.9479 WP_004193670.1.94901 WP_004193670.1.95054 WP_004193670.1.95300 WP_004193670.1.95339 WP_004193670.1.9537 WP_004193670.1.95587 WP_004193670.1.95644 WP_004193670.1.95672 WP_004193670.1.95938 WP_004193670.1.95952 WP_004193670.1.96660 WP_004193670.1.97058 WP_004193670.1.97112 WP_004193670.1.97148 WP_004193670.1.97989 WP_004193670.1.98066 WP_004193670.1.98316 WP_004193670.1.98491 WP_004193670.1.98547 WP_004193670.1.98688 WP_004193670.1.98713 WP_004193670.1.98753 WP_004193670.1.98768 WP_004193670.1.98944 WP_004193670.1.99061 WP_004193670.1.99069 WP_004193670.1.99160 WP_004193670.1.9962 WP_004193670.1.99629 WP_004193670.1.9975 WP_004193670.1.99890 YP_102823.1.87047 gi|53723407|ref|YP_102823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]