SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126452449|ref|YP_001067434.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126452449|ref|YP_001067434.1|
Domain Number 1 Region: 27-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.02e-41
Family Phosphate binding protein-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126452449|ref|YP_001067434.1|
Sequence length 260
Comment extracellular solute-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MRHFLTKPVGAALLAAAAALAQAHAAELHVMNSGGFTAAYQLLAPKFEAATGNTLDIAYG
PSMGATPEAIPNRLARGEPADVVIMVGYALDKLIREGKVEPGSRVELADSRIGAVVRAGE
PAPDIGTPAALKAALLQAKTVAYSDSASGVYVQNELFKRLGVEAEVKPKATMVPRVPVAS
KVADGTYALGFQQVSELLPVPGVTFVGKLPEPLQSVTRFAGGIPVGAKHPREARALLDYL
ASPAAAGDVRKTGLDPVPAR
Download sequence
Identical sequences A0A095MJL8 A0A0E1URM3 A0A0F6LBE2 A0A0H3HJZ0 A3NYL3
WP_004522223.1.101307 WP_004522223.1.10290 WP_004522223.1.10746 WP_004522223.1.10907 WP_004522223.1.11747 WP_004522223.1.11996 WP_004522223.1.12793 WP_004522223.1.12856 WP_004522223.1.13309 WP_004522223.1.13504 WP_004522223.1.13639 WP_004522223.1.14356 WP_004522223.1.14539 WP_004522223.1.14557 WP_004522223.1.1465 WP_004522223.1.15696 WP_004522223.1.16540 WP_004522223.1.16625 WP_004522223.1.16689 WP_004522223.1.17473 WP_004522223.1.18396 WP_004522223.1.18471 WP_004522223.1.18669 WP_004522223.1.18704 WP_004522223.1.19401 WP_004522223.1.19842 WP_004522223.1.21461 WP_004522223.1.23994 WP_004522223.1.24372 WP_004522223.1.2462 WP_004522223.1.25102 WP_004522223.1.25138 WP_004522223.1.25412 WP_004522223.1.25728 WP_004522223.1.259 WP_004522223.1.27069 WP_004522223.1.27420 WP_004522223.1.28187 WP_004522223.1.28632 WP_004522223.1.29161 WP_004522223.1.29335 WP_004522223.1.29405 WP_004522223.1.29853 WP_004522223.1.29887 WP_004522223.1.30671 WP_004522223.1.30937 WP_004522223.1.32174 WP_004522223.1.324 WP_004522223.1.33077 WP_004522223.1.33087 WP_004522223.1.33157 WP_004522223.1.34230 WP_004522223.1.35141 WP_004522223.1.35491 WP_004522223.1.37446 WP_004522223.1.37690 WP_004522223.1.37702 WP_004522223.1.37806 WP_004522223.1.38490 WP_004522223.1.38683 WP_004522223.1.3872 WP_004522223.1.39078 WP_004522223.1.39162 WP_004522223.1.39179 WP_004522223.1.39757 WP_004522223.1.39898 WP_004522223.1.40045 WP_004522223.1.42408 WP_004522223.1.43136 WP_004522223.1.43786 WP_004522223.1.45348 WP_004522223.1.45890 WP_004522223.1.46575 WP_004522223.1.46757 WP_004522223.1.46969 WP_004522223.1.47086 WP_004522223.1.47149 WP_004522223.1.48464 WP_004522223.1.50401 WP_004522223.1.5173 WP_004522223.1.52229 WP_004522223.1.52521 WP_004522223.1.52643 WP_004522223.1.52760 WP_004522223.1.53048 WP_004522223.1.53132 WP_004522223.1.53282 WP_004522223.1.54016 WP_004522223.1.54859 WP_004522223.1.55415 WP_004522223.1.5608 WP_004522223.1.56451 WP_004522223.1.56458 WP_004522223.1.57247 WP_004522223.1.5734 WP_004522223.1.58003 WP_004522223.1.58190 WP_004522223.1.59422 WP_004522223.1.59519 WP_004522223.1.60810 WP_004522223.1.60833 WP_004522223.1.61084 WP_004522223.1.61854 WP_004522223.1.61900 WP_004522223.1.62103 WP_004522223.1.62774 WP_004522223.1.63361 WP_004522223.1.63661 WP_004522223.1.64364 WP_004522223.1.64383 WP_004522223.1.64892 WP_004522223.1.66257 WP_004522223.1.67013 WP_004522223.1.67860 WP_004522223.1.67978 WP_004522223.1.68922 WP_004522223.1.69354 WP_004522223.1.70278 WP_004522223.1.70735 WP_004522223.1.71392 WP_004522223.1.71901 WP_004522223.1.72015 WP_004522223.1.72083 WP_004522223.1.72817 WP_004522223.1.73906 WP_004522223.1.74425 WP_004522223.1.75027 WP_004522223.1.75677 WP_004522223.1.75711 WP_004522223.1.75776 WP_004522223.1.76142 WP_004522223.1.76432 WP_004522223.1.766 WP_004522223.1.77689 WP_004522223.1.77845 WP_004522223.1.78029 WP_004522223.1.80098 WP_004522223.1.80433 WP_004522223.1.81042 WP_004522223.1.82394 WP_004522223.1.82575 WP_004522223.1.83357 WP_004522223.1.8341 WP_004522223.1.83543 WP_004522223.1.83567 WP_004522223.1.83688 WP_004522223.1.8390 WP_004522223.1.8395 WP_004522223.1.84026 WP_004522223.1.84866 WP_004522223.1.85412 WP_004522223.1.85584 WP_004522223.1.85645 WP_004522223.1.86295 WP_004522223.1.86438 WP_004522223.1.86525 WP_004522223.1.86806 WP_004522223.1.87278 WP_004522223.1.88237 WP_004522223.1.91025 WP_004522223.1.91700 WP_004522223.1.92367 WP_004522223.1.93845 WP_004522223.1.94286 WP_004522223.1.9537 WP_004522223.1.95938 WP_004522223.1.96381 WP_004522223.1.98218 WP_004522223.1.98547 WP_004522223.1.98768 WP_004522223.1.9962 WP_004522223.1.99919 357348.BURPS1106A_3196 gi|386860702|ref|YP_006273651.1| gi|126452449|ref|YP_001067434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]