SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126452555|ref|YP_001067291.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126452555|ref|YP_001067291.1|
Domain Number 1 Region: 25-412
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.48e-54
Family Phosphate binding protein-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126452555|ref|YP_001067291.1|
Sequence length 415
Comment carbohydrate ABC transporter periplasmic binding protein [Burkholderia pseudomallei 1106a]
Sequence
MKIRAIMGALGAAGLLFGAAAAQAAENVTVLHWWTSGGESKAVGVLKDDLQKQGYVWKDF
AVAGGAGAAAMTALKTKVISGDAPSAAQIKGPLIQEWADQGVLVNIDAAAGDWKQNLPPE
IDKIIKYKGNTVAAPFSVHRVNWLYINKAALDKIGAKPPATWPEFFQVADKLKAAGIQPV
AMGGQPWQDLTLWEDVVLSQGADFYRKALVELDQKTLTSDKMLEVFNTVRKIQGYFDSGR
NGRDWNLATAMVINGRAGMQFMGDWAKGEFEAAGKKPGKDYICAAVPGTANAYTFNVDSF
VFFQQKGQKAATPGQIALAKTIMTPAFQEQFSLLKGSIPVRLGVKMDKFDDCAKKSYADE
QTAIKSGGYVPSLAHGMAQGDATAGAISDVVTKFMNSQQDAKSALAALARAAKVK
Download sequence
Identical sequences A0A095QJI6 A0A0E1SB79 A0A0E1U8G3 A0A0E1UUL0 A0A0E1W4D6 A0A0F6GF92 A0A0F6LE75 A0A0H2WKY3 A0A290YAT8 A2S9F3 A3NCE0 A3NY70 A8EH89 B1HE43 C4AN20 C4KSX2 Q3JPP4 Q63RR0
gi|53725958|ref|YP_103699.1| 243160.BMA2129 272560.BPSL2611 320372.BURPS1710b_3086 320373.BURPS668_2998 320388.BMASAVP1_A0782 320389.BMA10247_1998 357348.BURPS1106A_3052 412022.BMA10229_A2615 536230.GBP346_A3189 gi|526470840|ref|YP_008342967.1| gi|403519716|ref|YP_006653850.1| gi|53720221|ref|YP_109207.1| gi|126449301|ref|YP_001081530.1| gi|556576403|ref|YP_008744910.1| WP_004185848.1.100104 WP_004185848.1.100195 WP_004185848.1.10047 WP_004185848.1.100583 WP_004185848.1.100720 WP_004185848.1.100727 WP_004185848.1.100825 WP_004185848.1.100900 WP_004185848.1.101060 WP_004185848.1.101307 WP_004185848.1.101783 WP_004185848.1.10269 WP_004185848.1.10290 WP_004185848.1.10359 WP_004185848.1.10746 WP_004185848.1.10907 WP_004185848.1.1098 WP_004185848.1.11160 WP_004185848.1.11268 WP_004185848.1.11747 WP_004185848.1.11825 WP_004185848.1.11893 WP_004185848.1.11996 WP_004185848.1.11998 WP_004185848.1.12731 WP_004185848.1.12793 WP_004185848.1.12856 WP_004185848.1.12860 WP_004185848.1.13198 WP_004185848.1.13309 WP_004185848.1.13520 WP_004185848.1.13603 WP_004185848.1.13639 WP_004185848.1.13925 WP_004185848.1.13950 WP_004185848.1.14356 WP_004185848.1.14557 WP_004185848.1.1465 WP_004185848.1.15170 WP_004185848.1.15364 WP_004185848.1.15525 WP_004185848.1.15673 WP_004185848.1.15696 WP_004185848.1.16090 WP_004185848.1.16113 WP_004185848.1.16249 WP_004185848.1.16358 WP_004185848.1.16540 WP_004185848.1.16625 WP_004185848.1.16680 WP_004185848.1.16689 WP_004185848.1.17473 WP_004185848.1.17748 WP_004185848.1.17786 WP_004185848.1.18058 WP_004185848.1.18396 WP_004185848.1.18405 WP_004185848.1.18471 WP_004185848.1.18549 WP_004185848.1.18631 WP_004185848.1.18669 WP_004185848.1.18704 WP_004185848.1.18744 WP_004185848.1.18868 WP_004185848.1.18906 WP_004185848.1.19401 WP_004185848.1.19540 WP_004185848.1.19629 WP_004185848.1.1976 WP_004185848.1.19815 WP_004185848.1.19842 WP_004185848.1.19854 WP_004185848.1.20501 WP_004185848.1.20531 WP_004185848.1.20673 WP_004185848.1.20954 WP_004185848.1.21147 WP_004185848.1.21205 WP_004185848.1.21291 WP_004185848.1.21304 WP_004185848.1.21442 WP_004185848.1.21461 WP_004185848.1.21653 WP_004185848.1.21809 WP_004185848.1.21907 WP_004185848.1.22299 WP_004185848.1.22329 WP_004185848.1.22625 WP_004185848.1.22779 WP_004185848.1.23009 WP_004185848.1.23086 WP_004185848.1.23131 WP_004185848.1.2317 WP_004185848.1.23385 WP_004185848.1.23743 WP_004185848.1.23994 WP_004185848.1.24020 WP_004185848.1.2404 WP_004185848.1.24134 WP_004185848.1.24372 WP_004185848.1.24513 WP_004185848.1.2462 WP_004185848.1.24701 WP_004185848.1.25102 WP_004185848.1.25138 WP_004185848.1.25265 WP_004185848.1.25412 WP_004185848.1.25628 WP_004185848.1.25728 WP_004185848.1.259 WP_004185848.1.26445 WP_004185848.1.26565 WP_004185848.1.26633 WP_004185848.1.26838 WP_004185848.1.27069 WP_004185848.1.27146 WP_004185848.1.27363 WP_004185848.1.27390 WP_004185848.1.27399 WP_004185848.1.27420 WP_004185848.1.27441 WP_004185848.1.2767 WP_004185848.1.27810 WP_004185848.1.27909 WP_004185848.1.28066 WP_004185848.1.28187 WP_004185848.1.28453 WP_004185848.1.28594 WP_004185848.1.28619 WP_004185848.1.28632 WP_004185848.1.29148 WP_004185848.1.29161 WP_004185848.1.29178 WP_004185848.1.29335 WP_004185848.1.29405 WP_004185848.1.29520 WP_004185848.1.29547 WP_004185848.1.29658 WP_004185848.1.29853 WP_004185848.1.29887 WP_004185848.1.29899 WP_004185848.1.29948 WP_004185848.1.30382 WP_004185848.1.30671 WP_004185848.1.3069 WP_004185848.1.30729 WP_004185848.1.30937 WP_004185848.1.30966 WP_004185848.1.31343 WP_004185848.1.31723 WP_004185848.1.31831 WP_004185848.1.32174 WP_004185848.1.32221 WP_004185848.1.324 WP_004185848.1.3251 WP_004185848.1.32581 WP_004185848.1.32951 WP_004185848.1.33077 WP_004185848.1.33087 WP_004185848.1.33130 WP_004185848.1.33157 WP_004185848.1.33158 WP_004185848.1.33165 WP_004185848.1.33419 WP_004185848.1.33493 WP_004185848.1.33543 WP_004185848.1.34230 WP_004185848.1.34333 WP_004185848.1.34564 WP_004185848.1.34747 WP_004185848.1.35025 WP_004185848.1.35052 WP_004185848.1.35227 WP_004185848.1.35249 WP_004185848.1.35474 WP_004185848.1.35491 WP_004185848.1.35757 WP_004185848.1.35878 WP_004185848.1.36106 WP_004185848.1.36174 WP_004185848.1.366 WP_004185848.1.36662 WP_004185848.1.36666 WP_004185848.1.36944 WP_004185848.1.37 WP_004185848.1.37373 WP_004185848.1.37446 WP_004185848.1.37517 WP_004185848.1.37519 WP_004185848.1.37535 WP_004185848.1.37627 WP_004185848.1.37690 WP_004185848.1.37702 WP_004185848.1.37806 WP_004185848.1.37934 WP_004185848.1.37959 WP_004185848.1.37994 WP_004185848.1.38115 WP_004185848.1.38442 WP_004185848.1.38490 WP_004185848.1.38683 WP_004185848.1.3872 WP_004185848.1.38810 WP_004185848.1.38946 WP_004185848.1.39078 WP_004185848.1.39162 WP_004185848.1.39179 WP_004185848.1.39349 WP_004185848.1.3947 WP_004185848.1.39757 WP_004185848.1.39898 WP_004185848.1.40021 WP_004185848.1.40045 WP_004185848.1.40191 WP_004185848.1.40235 WP_004185848.1.40426 WP_004185848.1.40448 WP_004185848.1.4077 WP_004185848.1.41477 WP_004185848.1.41588 WP_004185848.1.41945 WP_004185848.1.42408 WP_004185848.1.42492 WP_004185848.1.42496 WP_004185848.1.42800 WP_004185848.1.43136 WP_004185848.1.43156 WP_004185848.1.43373 WP_004185848.1.43581 WP_004185848.1.43678 WP_004185848.1.43727 WP_004185848.1.43786 WP_004185848.1.43899 WP_004185848.1.44179 WP_004185848.1.44234 WP_004185848.1.44414 WP_004185848.1.44540 WP_004185848.1.44824 WP_004185848.1.45348 WP_004185848.1.45356 WP_004185848.1.45890 WP_004185848.1.46575 WP_004185848.1.46757 WP_004185848.1.46829 WP_004185848.1.46969 WP_004185848.1.47086 WP_004185848.1.4718 WP_004185848.1.4810 WP_004185848.1.48165 WP_004185848.1.48313 WP_004185848.1.48407 WP_004185848.1.48464 WP_004185848.1.49026 WP_004185848.1.49717 WP_004185848.1.50336 WP_004185848.1.50401 WP_004185848.1.50636 WP_004185848.1.50788 WP_004185848.1.50839 WP_004185848.1.5105 WP_004185848.1.51606 WP_004185848.1.5173 WP_004185848.1.5182 WP_004185848.1.51902 WP_004185848.1.52229 WP_004185848.1.52407 WP_004185848.1.52451 WP_004185848.1.52521 WP_004185848.1.52547 WP_004185848.1.52643 WP_004185848.1.52655 WP_004185848.1.52731 WP_004185848.1.52760 WP_004185848.1.52882 WP_004185848.1.5292 WP_004185848.1.53034 WP_004185848.1.53048 WP_004185848.1.53103 WP_004185848.1.53282 WP_004185848.1.5338 WP_004185848.1.53386 WP_004185848.1.53506 WP_004185848.1.53578 WP_004185848.1.53977 WP_004185848.1.54016 WP_004185848.1.5413 WP_004185848.1.54312 WP_004185848.1.54369 WP_004185848.1.54804 WP_004185848.1.54859 WP_004185848.1.54892 WP_004185848.1.55038 WP_004185848.1.55415 WP_004185848.1.55691 WP_004185848.1.55755 WP_004185848.1.55974 WP_004185848.1.55996 WP_004185848.1.5608 WP_004185848.1.56126 WP_004185848.1.56248 WP_004185848.1.5641 WP_004185848.1.56451 WP_004185848.1.56458 WP_004185848.1.56591 WP_004185848.1.56744 WP_004185848.1.56949 WP_004185848.1.56993 WP_004185848.1.57046 WP_004185848.1.57096 WP_004185848.1.57247 WP_004185848.1.5734 WP_004185848.1.57341 WP_004185848.1.57359 WP_004185848.1.57679 WP_004185848.1.5776 WP_004185848.1.58003 WP_004185848.1.58105 WP_004185848.1.58190 WP_004185848.1.58355 WP_004185848.1.58362 WP_004185848.1.58390 WP_004185848.1.58405 WP_004185848.1.58509 WP_004185848.1.58523 WP_004185848.1.58578 WP_004185848.1.58639 WP_004185848.1.58758 WP_004185848.1.5883 WP_004185848.1.59103 WP_004185848.1.59255 WP_004185848.1.59422 WP_004185848.1.59496 WP_004185848.1.59519 WP_004185848.1.59536 WP_004185848.1.60398 WP_004185848.1.60769 WP_004185848.1.60810 WP_004185848.1.60833 WP_004185848.1.60836 WP_004185848.1.60969 WP_004185848.1.61073 WP_004185848.1.61084 WP_004185848.1.61588 WP_004185848.1.61685 WP_004185848.1.61723 WP_004185848.1.61854 WP_004185848.1.6186 WP_004185848.1.61900 WP_004185848.1.62103 WP_004185848.1.62774 WP_004185848.1.63097 WP_004185848.1.63261 WP_004185848.1.63361 WP_004185848.1.63379 WP_004185848.1.63439 WP_004185848.1.63505 WP_004185848.1.63661 WP_004185848.1.63719 WP_004185848.1.63942 WP_004185848.1.64068 WP_004185848.1.64204 WP_004185848.1.64364 WP_004185848.1.64383 WP_004185848.1.64542 WP_004185848.1.64683 WP_004185848.1.64892 WP_004185848.1.65093 WP_004185848.1.65270 WP_004185848.1.65832 WP_004185848.1.65994 WP_004185848.1.66257 WP_004185848.1.66321 WP_004185848.1.66380 WP_004185848.1.66465 WP_004185848.1.66594 WP_004185848.1.67013 WP_004185848.1.67117 WP_004185848.1.67182 WP_004185848.1.67393 WP_004185848.1.67559 WP_004185848.1.6765 WP_004185848.1.67860 WP_004185848.1.67909 WP_004185848.1.67914 WP_004185848.1.67978 WP_004185848.1.68353 WP_004185848.1.68664 WP_004185848.1.68886 WP_004185848.1.68922 WP_004185848.1.69081 WP_004185848.1.69094 WP_004185848.1.69169 WP_004185848.1.69217 WP_004185848.1.69337 WP_004185848.1.69354 WP_004185848.1.69508 WP_004185848.1.69918 WP_004185848.1.7006 WP_004185848.1.70066 WP_004185848.1.70096 WP_004185848.1.70278 WP_004185848.1.70280 WP_004185848.1.70735 WP_004185848.1.71392 WP_004185848.1.71444 WP_004185848.1.71564 WP_004185848.1.71901 WP_004185848.1.72015 WP_004185848.1.72083 WP_004185848.1.72545 WP_004185848.1.72817 WP_004185848.1.73317 WP_004185848.1.73521 WP_004185848.1.73576 WP_004185848.1.73906 WP_004185848.1.73974 WP_004185848.1.74177 WP_004185848.1.74425 WP_004185848.1.7450 WP_004185848.1.74675 WP_004185848.1.74690 WP_004185848.1.75001 WP_004185848.1.75027 WP_004185848.1.75075 WP_004185848.1.75230 WP_004185848.1.75276 WP_004185848.1.75519 WP_004185848.1.75677 WP_004185848.1.75708 WP_004185848.1.75711 WP_004185848.1.75861 WP_004185848.1.75883 WP_004185848.1.75937 WP_004185848.1.76142 WP_004185848.1.76290 WP_004185848.1.76432 WP_004185848.1.76522 WP_004185848.1.76575 WP_004185848.1.766 WP_004185848.1.77249 WP_004185848.1.77689 WP_004185848.1.77845 WP_004185848.1.78029 WP_004185848.1.78278 WP_004185848.1.78506 WP_004185848.1.78557 WP_004185848.1.78628 WP_004185848.1.78759 WP_004185848.1.78807 WP_004185848.1.78827 WP_004185848.1.79052 WP_004185848.1.79360 WP_004185848.1.795 WP_004185848.1.79653 WP_004185848.1.79725 WP_004185848.1.79782 WP_004185848.1.80098 WP_004185848.1.80302 WP_004185848.1.80395 WP_004185848.1.80433 WP_004185848.1.80614 WP_004185848.1.80923 WP_004185848.1.81042 WP_004185848.1.8126 WP_004185848.1.81511 WP_004185848.1.81543 WP_004185848.1.81665 WP_004185848.1.82283 WP_004185848.1.82323 WP_004185848.1.82394 WP_004185848.1.82506 WP_004185848.1.82575 WP_004185848.1.82694 WP_004185848.1.82950 WP_004185848.1.83357 WP_004185848.1.8341 WP_004185848.1.83487 WP_004185848.1.83543 WP_004185848.1.83567 WP_004185848.1.83609 WP_004185848.1.83688 WP_004185848.1.8388 WP_004185848.1.8395 WP_004185848.1.83967 WP_004185848.1.84002 WP_004185848.1.84026 WP_004185848.1.84063 WP_004185848.1.84181 WP_004185848.1.84375 WP_004185848.1.84379 WP_004185848.1.84480 WP_004185848.1.84654 WP_004185848.1.85170 WP_004185848.1.85412 WP_004185848.1.85443 WP_004185848.1.85467 WP_004185848.1.85584 WP_004185848.1.85641 WP_004185848.1.85645 WP_004185848.1.85774 WP_004185848.1.8585 WP_004185848.1.86295 WP_004185848.1.86438 WP_004185848.1.86525 WP_004185848.1.86806 WP_004185848.1.86872 WP_004185848.1.8697 WP_004185848.1.87114 WP_004185848.1.87278 WP_004185848.1.87324 WP_004185848.1.87553 WP_004185848.1.87652 WP_004185848.1.87811 WP_004185848.1.88003 WP_004185848.1.88117 WP_004185848.1.88168 WP_004185848.1.88237 WP_004185848.1.88411 WP_004185848.1.88682 WP_004185848.1.89093 WP_004185848.1.90934 WP_004185848.1.91025 WP_004185848.1.91142 WP_004185848.1.91198 WP_004185848.1.91700 WP_004185848.1.91709 WP_004185848.1.91763 WP_004185848.1.9236 WP_004185848.1.92367 WP_004185848.1.92430 WP_004185848.1.92493 WP_004185848.1.92507 WP_004185848.1.9280 WP_004185848.1.9281 WP_004185848.1.92904 WP_004185848.1.93844 WP_004185848.1.93845 WP_004185848.1.94050 WP_004185848.1.94117 WP_004185848.1.94121 WP_004185848.1.94403 WP_004185848.1.94498 WP_004185848.1.94520 WP_004185848.1.9479 WP_004185848.1.94901 WP_004185848.1.94926 WP_004185848.1.95054 WP_004185848.1.95300 WP_004185848.1.95339 WP_004185848.1.9537 WP_004185848.1.95587 WP_004185848.1.95644 WP_004185848.1.95672 WP_004185848.1.95938 WP_004185848.1.95952 WP_004185848.1.96381 WP_004185848.1.96660 WP_004185848.1.97058 WP_004185848.1.97112 WP_004185848.1.97148 WP_004185848.1.98066 WP_004185848.1.98218 WP_004185848.1.98491 WP_004185848.1.98547 WP_004185848.1.98688 WP_004185848.1.98713 WP_004185848.1.98753 WP_004185848.1.98768 WP_004185848.1.98944 WP_004185848.1.99061 WP_004185848.1.99160 WP_004185848.1.99290 WP_004185848.1.9962 WP_004185848.1.99629 WP_004185848.1.9975 WP_004185848.1.9983 WP_004185848.1.99890 WP_004185848.1.99919 YP_103699.1.87047 YP_109207.1.59693 gi|126440650|ref|YP_001060011.1| gi|121599849|ref|YP_992127.1| gi|237813414|ref|YP_002897865.1| gi|124383343|ref|YP_001028572.1| gi|76810966|ref|YP_334459.1| gi|126452555|ref|YP_001067291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]