SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126452998|ref|YP_001066143.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126452998|ref|YP_001066143.1|
Domain Number 1 Region: 50-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.23e-27
Family Phosphate binding protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126452998|ref|YP_001066143.1|
Sequence length 348
Comment ABC transporter substrate binding protein [Burkholderia pseudomallei 1106a]
Sequence
MTRASSLGRRSLSLTAALAVLVAALAAASLVAAPAARAEGRIRVAEQFGIVYLLLNVARD
RHLIEQAGRAEGIAIDVDWVKLSGGAAINDALLSGSIDIAGAGVGPLLTIWDRTRGRQNV
KGVASLGNLPYYLVSNDPRVKTIADFTARERIAVPAVTVSVQSRLLQFAAAQRWGDRAYD
RLDKLTQAVAHPDAAAAIIAGRTELTAHFGNPPFQEQELAANPNAHIVLSSYDVLGGPSS
ATVLYATERFRRDNPKTYRAFVAALGQAARYVQTNPEGAVDAYLRVNGSKADRALLLKIV
RNPQVQFRIAPQNTFALAAFMHRVGAIRHEPKTWRDYFFDDPATAQGS
Download sequence
Identical sequences A0A069B169 A0A0E1TWW4 A0A0E1UM67 A0A0E1WA95 A0A0F6GCV3 A2S326 A3N980 A3NUX2 A8EDY1 B1HIS5 C4KXC0 Q3JSM6
320372.BURPS1710b_2032 320373.BURPS668_1866 320388.BMASAVP1_A1687 320389.BMA10247_0818 357348.BURPS1106A_1878 412022.BMA10229_A0343 536230.GBP346_A1903 NYSGRC-SEC-76808922 gi|124385943|ref|YP_001026345.1| gi|126452998|ref|YP_001066143.1| gi|126449961|ref|YP_001080381.1| gi|237812157|ref|YP_002896608.1| gi|121598697|ref|YP_993013.1| WP_004193173.1.100104 WP_004193173.1.10047 WP_004193173.1.100583 WP_004193173.1.100720 WP_004193173.1.100727 WP_004193173.1.100825 WP_004193173.1.1010 WP_004193173.1.101381 WP_004193173.1.101559 WP_004193173.1.101588 WP_004193173.1.101783 WP_004193173.1.102051 WP_004193173.1.10269 WP_004193173.1.10907 WP_004193173.1.11046 WP_004193173.1.11825 WP_004193173.1.11893 WP_004193173.1.1266 WP_004193173.1.12731 WP_004193173.1.12793 WP_004193173.1.12856 WP_004193173.1.12860 WP_004193173.1.13597 WP_004193173.1.13639 WP_004193173.1.13925 WP_004193173.1.14660 WP_004193173.1.15170 WP_004193173.1.15364 WP_004193173.1.15525 WP_004193173.1.15673 WP_004193173.1.16249 WP_004193173.1.16358 WP_004193173.1.16540 WP_004193173.1.16625 WP_004193173.1.16680 WP_004193173.1.16689 WP_004193173.1.16749 WP_004193173.1.17068 WP_004193173.1.17278 WP_004193173.1.17748 WP_004193173.1.17786 WP_004193173.1.18396 WP_004193173.1.18405 WP_004193173.1.18704 WP_004193173.1.18744 WP_004193173.1.18868 WP_004193173.1.18906 WP_004193173.1.19629 WP_004193173.1.20021 WP_004193173.1.20246 WP_004193173.1.20520 WP_004193173.1.20531 WP_004193173.1.21147 WP_004193173.1.21205 WP_004193173.1.21409 WP_004193173.1.21442 WP_004193173.1.21461 WP_004193173.1.21809 WP_004193173.1.21907 WP_004193173.1.22046 WP_004193173.1.22299 WP_004193173.1.22329 WP_004193173.1.22625 WP_004193173.1.23743 WP_004193173.1.23852 WP_004193173.1.23994 WP_004193173.1.2404 WP_004193173.1.24134 WP_004193173.1.24314 WP_004193173.1.24372 WP_004193173.1.24701 WP_004193173.1.25068 WP_004193173.1.25102 WP_004193173.1.25412 WP_004193173.1.25628 WP_004193173.1.26054 WP_004193173.1.26445 WP_004193173.1.26502 WP_004193173.1.26633 WP_004193173.1.267 WP_004193173.1.26849 WP_004193173.1.27064 WP_004193173.1.27069 WP_004193173.1.27363 WP_004193173.1.27390 WP_004193173.1.27399 WP_004193173.1.27420 WP_004193173.1.27597 WP_004193173.1.27909 WP_004193173.1.28018 WP_004193173.1.28453 WP_004193173.1.28594 WP_004193173.1.29148 WP_004193173.1.29335 WP_004193173.1.29405 WP_004193173.1.29508 WP_004193173.1.29547 WP_004193173.1.29658 WP_004193173.1.29853 WP_004193173.1.29899 WP_004193173.1.29948 WP_004193173.1.3041 WP_004193173.1.30671 WP_004193173.1.30729 WP_004193173.1.31343 WP_004193173.1.31831 WP_004193173.1.32182 WP_004193173.1.3251 WP_004193173.1.3273 WP_004193173.1.33077 WP_004193173.1.33157 WP_004193173.1.332 WP_004193173.1.33366 WP_004193173.1.33419 WP_004193173.1.33493 WP_004193173.1.33543 WP_004193173.1.33573 WP_004193173.1.33779 WP_004193173.1.34230 WP_004193173.1.34393 WP_004193173.1.34564 WP_004193173.1.35025 WP_004193173.1.35052 WP_004193173.1.35090 WP_004193173.1.35227 WP_004193173.1.35249 WP_004193173.1.35474 WP_004193173.1.35485 WP_004193173.1.35491 WP_004193173.1.35878 WP_004193173.1.36106 WP_004193173.1.36174 WP_004193173.1.36259 WP_004193173.1.366 WP_004193173.1.36666 WP_004193173.1.36944 WP_004193173.1.37 WP_004193173.1.3706 WP_004193173.1.37373 WP_004193173.1.37428 WP_004193173.1.37581 WP_004193173.1.37622 WP_004193173.1.37627 WP_004193173.1.37690 WP_004193173.1.37725 WP_004193173.1.37959 WP_004193173.1.38115 WP_004193173.1.38442 WP_004193173.1.38490 WP_004193173.1.3872 WP_004193173.1.38810 WP_004193173.1.39078 WP_004193173.1.39162 WP_004193173.1.39179 WP_004193173.1.39349 WP_004193173.1.3947 WP_004193173.1.39595 WP_004193173.1.39757 WP_004193173.1.40191 WP_004193173.1.40235 WP_004193173.1.40275 WP_004193173.1.40388 WP_004193173.1.4077 WP_004193173.1.41477 WP_004193173.1.41945 WP_004193173.1.42408 WP_004193173.1.42492 WP_004193173.1.42496 WP_004193173.1.43136 WP_004193173.1.43156 WP_004193173.1.43373 WP_004193173.1.43581 WP_004193173.1.43587 WP_004193173.1.43727 WP_004193173.1.43786 WP_004193173.1.43899 WP_004193173.1.44234 WP_004193173.1.44414 WP_004193173.1.44540 WP_004193173.1.45284 WP_004193173.1.45356 WP_004193173.1.45537 WP_004193173.1.45715 WP_004193173.1.4631 WP_004193173.1.46757 WP_004193173.1.46969 WP_004193173.1.47086 WP_004193173.1.48093 WP_004193173.1.4810 WP_004193173.1.48165 WP_004193173.1.48313 WP_004193173.1.48464 WP_004193173.1.49717 WP_004193173.1.49872 WP_004193173.1.50174 WP_004193173.1.50788 WP_004193173.1.5105 WP_004193173.1.51606 WP_004193173.1.5173 WP_004193173.1.5182 WP_004193173.1.52229 WP_004193173.1.52547 WP_004193173.1.52643 WP_004193173.1.52655 WP_004193173.1.52731 WP_004193173.1.52882 WP_004193173.1.5292 WP_004193173.1.53034 WP_004193173.1.53048 WP_004193173.1.53386 WP_004193173.1.53506 WP_004193173.1.54016 WP_004193173.1.5413 WP_004193173.1.54369 WP_004193173.1.54859 WP_004193173.1.54892 WP_004193173.1.55038 WP_004193173.1.5608 WP_004193173.1.56126 WP_004193173.1.56248 WP_004193173.1.5641 WP_004193173.1.56744 WP_004193173.1.56949 WP_004193173.1.57046 WP_004193173.1.57096 WP_004193173.1.57247 WP_004193173.1.57341 WP_004193173.1.57679 WP_004193173.1.5776 WP_004193173.1.58003 WP_004193173.1.58105 WP_004193173.1.58355 WP_004193173.1.58362 WP_004193173.1.58405 WP_004193173.1.58509 WP_004193173.1.58523 WP_004193173.1.58578 WP_004193173.1.58758 WP_004193173.1.59200 WP_004193173.1.59255 WP_004193173.1.59422 WP_004193173.1.59519 WP_004193173.1.59747 WP_004193173.1.60810 WP_004193173.1.60836 WP_004193173.1.61073 WP_004193173.1.61084 WP_004193173.1.61202 WP_004193173.1.61588 WP_004193173.1.61723 WP_004193173.1.6186 WP_004193173.1.63379 WP_004193173.1.63505 WP_004193173.1.63942 WP_004193173.1.64068 WP_004193173.1.64096 WP_004193173.1.64364 WP_004193173.1.64383 WP_004193173.1.64542 WP_004193173.1.64892 WP_004193173.1.65270 WP_004193173.1.65468 WP_004193173.1.65832 WP_004193173.1.65994 WP_004193173.1.66594 WP_004193173.1.67117 WP_004193173.1.67559 WP_004193173.1.6765 WP_004193173.1.67860 WP_004193173.1.67914 WP_004193173.1.6835 WP_004193173.1.68353 WP_004193173.1.69022 WP_004193173.1.69094 WP_004193173.1.69169 WP_004193173.1.69217 WP_004193173.1.69770 WP_004193173.1.70016 WP_004193173.1.7006 WP_004193173.1.70066 WP_004193173.1.70096 WP_004193173.1.70278 WP_004193173.1.70280 WP_004193173.1.71392 WP_004193173.1.71444 WP_004193173.1.71564 WP_004193173.1.71901 WP_004193173.1.72015 WP_004193173.1.72545 WP_004193173.1.72798 WP_004193173.1.72817 WP_004193173.1.73317 WP_004193173.1.73418 WP_004193173.1.73576 WP_004193173.1.73974 WP_004193173.1.74425 WP_004193173.1.74569 WP_004193173.1.74675 WP_004193173.1.74690 WP_004193173.1.75001 WP_004193173.1.75075 WP_004193173.1.75230 WP_004193173.1.75677 WP_004193173.1.75711 WP_004193173.1.75861 WP_004193173.1.75913 WP_004193173.1.75937 WP_004193173.1.76142 WP_004193173.1.76290 WP_004193173.1.76522 WP_004193173.1.76575 WP_004193173.1.766 WP_004193173.1.7703 WP_004193173.1.77249 WP_004193173.1.77319 WP_004193173.1.77689 WP_004193173.1.77788 WP_004193173.1.77845 WP_004193173.1.78278 WP_004193173.1.78557 WP_004193173.1.78628 WP_004193173.1.78759 WP_004193173.1.78827 WP_004193173.1.79052 WP_004193173.1.79360 WP_004193173.1.795 WP_004193173.1.79710 WP_004193173.1.79725 WP_004193173.1.79782 WP_004193173.1.80302 WP_004193173.1.80395 WP_004193173.1.80433 WP_004193173.1.80614 WP_004193173.1.80923 WP_004193173.1.81042 WP_004193173.1.8126 WP_004193173.1.81479 WP_004193173.1.81511 WP_004193173.1.82394 WP_004193173.1.82506 WP_004193173.1.82727 WP_004193173.1.83080 WP_004193173.1.83357 WP_004193173.1.8341 WP_004193173.1.83487 WP_004193173.1.83543 WP_004193173.1.83609 WP_004193173.1.83688 WP_004193173.1.8388 WP_004193173.1.8390 WP_004193173.1.84002 WP_004193173.1.84026 WP_004193173.1.84063 WP_004193173.1.84181 WP_004193173.1.84379 WP_004193173.1.84480 WP_004193173.1.85412 WP_004193173.1.85443 WP_004193173.1.85467 WP_004193173.1.85565 WP_004193173.1.856 WP_004193173.1.85641 WP_004193173.1.85774 WP_004193173.1.8629 WP_004193173.1.86438 WP_004193173.1.86525 WP_004193173.1.86806 WP_004193173.1.86872 WP_004193173.1.87114 WP_004193173.1.87278 WP_004193173.1.87324 WP_004193173.1.87652 WP_004193173.1.87759 WP_004193173.1.88168 WP_004193173.1.88237 WP_004193173.1.88369 WP_004193173.1.88666 WP_004193173.1.88764 WP_004193173.1.89240 WP_004193173.1.89435 WP_004193173.1.89782 WP_004193173.1.90471 WP_004193173.1.91025 WP_004193173.1.91142 WP_004193173.1.91763 WP_004193173.1.9236 WP_004193173.1.92367 WP_004193173.1.92406 WP_004193173.1.92430 WP_004193173.1.92493 WP_004193173.1.92507 WP_004193173.1.9280 WP_004193173.1.9281 WP_004193173.1.93845 WP_004193173.1.94050 WP_004193173.1.94117 WP_004193173.1.94901 WP_004193173.1.95300 WP_004193173.1.95587 WP_004193173.1.95644 WP_004193173.1.95672 WP_004193173.1.95938 WP_004193173.1.96381 WP_004193173.1.96660 WP_004193173.1.97112 WP_004193173.1.97989 WP_004193173.1.98066 WP_004193173.1.98316 WP_004193173.1.98547 WP_004193173.1.98688 WP_004193173.1.98753 WP_004193173.1.98768 WP_004193173.1.98944 WP_004193173.1.99061 WP_004193173.1.99069 WP_004193173.1.99160 WP_004193173.1.9962 WP_004193173.1.99629 WP_004193173.1.9975 WP_004193173.1.9983 WP_004193173.1.99890 gi|76808922|ref|YP_333427.1| gi|126441454|ref|YP_001058901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]