SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126453397|ref|YP_001065046.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126453397|ref|YP_001065046.1|
Domain Number 1 Region: 49-249
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-37
Family Phosphate binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126453397|ref|YP_001065046.1|
Sequence length 274
Comment LysR substrate binding domain-containing protein [Burkholderia pseudomallei 1106a]
Sequence
MNGSPRPGATRPTSTPATSEGETYLGYATRIVADIRRMADAVRASRSVPRGLLRVNVMLG
FGRTTITPLVSEFATPHPRVEVRLDVTDRPVDRVDGGFDFAIRFGEPPDTRLNARRIMSN
RRLLRASPVHLQRRGAPASLARCIVHRRNDDAHGVWRFVRDGEAEGVKVRAAPSSNDGDI
VPGWALDGHGILIRSEWDLAKYLESGRLRRVLPEYALPSADLSACYPVRRNPSARARAPI
DFLVARLGASAPAPARTPEGGRRAGSRDVPPRVR
Download sequence
Identical sequences A3NRS5 B1HFJ8
gi|126453397|ref|YP_001065046.1| gi|403517417|ref|YP_006651550.1| WP_004534256.1.100720 WP_004534256.1.10907 WP_004534256.1.12856 WP_004534256.1.13639 WP_004534256.1.15170 WP_004534256.1.15364 WP_004534256.1.15525 WP_004534256.1.15673 WP_004534256.1.16249 WP_004534256.1.16689 WP_004534256.1.18396 WP_004534256.1.21147 WP_004534256.1.21205 WP_004534256.1.23994 WP_004534256.1.25628 WP_004534256.1.27069 WP_004534256.1.27420 WP_004534256.1.29335 WP_004534256.1.29405 WP_004534256.1.29547 WP_004534256.1.29658 WP_004534256.1.29853 WP_004534256.1.29887 WP_004534256.1.29899 WP_004534256.1.35249 WP_004534256.1.35474 WP_004534256.1.36666 WP_004534256.1.37 WP_004534256.1.37690 WP_004534256.1.38490 WP_004534256.1.39162 WP_004534256.1.39757 WP_004534256.1.41945 WP_004534256.1.42408 WP_004534256.1.43136 WP_004534256.1.43786 WP_004534256.1.44414 WP_004534256.1.46757 WP_004534256.1.48464 WP_004534256.1.49717 WP_004534256.1.5182 WP_004534256.1.52229 WP_004534256.1.52547 WP_004534256.1.52643 WP_004534256.1.52655 WP_004534256.1.52731 WP_004534256.1.53048 WP_004534256.1.54016 WP_004534256.1.55038 WP_004534256.1.5608 WP_004534256.1.56126 WP_004534256.1.5641 WP_004534256.1.56744 WP_004534256.1.57046 WP_004534256.1.57247 WP_004534256.1.57341 WP_004534256.1.5776 WP_004534256.1.58003 WP_004534256.1.59519 WP_004534256.1.61084 WP_004534256.1.61723 WP_004534256.1.6186 WP_004534256.1.63942 WP_004534256.1.64068 WP_004534256.1.64383 WP_004534256.1.64542 WP_004534256.1.67117 WP_004534256.1.67559 WP_004534256.1.67860 WP_004534256.1.68922 WP_004534256.1.7006 WP_004534256.1.70066 WP_004534256.1.70278 WP_004534256.1.71444 WP_004534256.1.71564 WP_004534256.1.71901 WP_004534256.1.72015 WP_004534256.1.72817 WP_004534256.1.73974 WP_004534256.1.74425 WP_004534256.1.74690 WP_004534256.1.75711 WP_004534256.1.75937 WP_004534256.1.76142 WP_004534256.1.766 WP_004534256.1.77249 WP_004534256.1.77689 WP_004534256.1.78628 WP_004534256.1.78807 WP_004534256.1.79360 WP_004534256.1.80302 WP_004534256.1.80433 WP_004534256.1.80923 WP_004534256.1.82394 WP_004534256.1.82506 WP_004534256.1.83357 WP_004534256.1.83543 WP_004534256.1.83609 WP_004534256.1.83688 WP_004534256.1.84026 WP_004534256.1.85412 WP_004534256.1.86525 WP_004534256.1.87278 WP_004534256.1.87324 WP_004534256.1.88237 WP_004534256.1.91025 WP_004534256.1.91142 WP_004534256.1.92430 WP_004534256.1.92493 WP_004534256.1.94901 WP_004534256.1.95300 WP_004534256.1.95587 WP_004534256.1.95644 WP_004534256.1.97112 WP_004534256.1.98547 WP_004534256.1.98688 WP_004534256.1.99160 WP_004534256.1.9962 WP_004534256.1.99629 WP_004534256.1.99890 357348.BURPS1106A_0764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]