SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126453440|ref|YP_001067174.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126453440|ref|YP_001067174.1|
Domain Number 1 Region: 30-266
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.68e-88
Family Phosphate binding protein-like 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126453440|ref|YP_001067174.1|
Sequence length 266
Comment D-methionine ABC transporter periplasmic D-methionine-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MQRRTMLKLAAALGAAVCVAGAQAQAQTQTIKVGVTGGPHAQVMEEVKKVAAKHGLDIRI
VEFSDYVQPNAALAAGDLDANSYQHAPYLDAQVKDRGYRIVKVADTVTFPMGVYSKRVNS
LAALRAGARIAIPNDPTNGGRALLLLQKQGLLKLRDGAGLKATRFDVVDNPKQLKLVELD
AAQIPRSLADVDAAAINTNYAMEAGLKPKQDAIAIEGPNGPYANILAVRAEDKDKPWVAK
LVAAYRSADVKRFIERQFGGAVIAAW
Download sequence
Identical sequences A3NXV3
gi|403519596|ref|YP_006653730.1| WP_004550119.1.1010 WP_004550119.1.101381 WP_004550119.1.101559 WP_004550119.1.101588 WP_004550119.1.11893 WP_004550119.1.12860 WP_004550119.1.13520 WP_004550119.1.13597 WP_004550119.1.14660 WP_004550119.1.16249 WP_004550119.1.16749 WP_004550119.1.17068 WP_004550119.1.17278 WP_004550119.1.1976 WP_004550119.1.20021 WP_004550119.1.20246 WP_004550119.1.20520 WP_004550119.1.21907 WP_004550119.1.22046 WP_004550119.1.24314 WP_004550119.1.24701 WP_004550119.1.25068 WP_004550119.1.26502 WP_004550119.1.267 WP_004550119.1.26849 WP_004550119.1.27064 WP_004550119.1.27399 WP_004550119.1.27597 WP_004550119.1.28018 WP_004550119.1.28594 WP_004550119.1.29508 WP_004550119.1.29853 WP_004550119.1.3069 WP_004550119.1.32182 WP_004550119.1.3273 WP_004550119.1.332 WP_004550119.1.33366 WP_004550119.1.33573 WP_004550119.1.33779 WP_004550119.1.34393 WP_004550119.1.35090 WP_004550119.1.35485 WP_004550119.1.36106 WP_004550119.1.36174 WP_004550119.1.36259 WP_004550119.1.366 WP_004550119.1.3706 WP_004550119.1.37373 WP_004550119.1.37428 WP_004550119.1.37581 WP_004550119.1.37622 WP_004550119.1.37725 WP_004550119.1.38115 WP_004550119.1.3872 WP_004550119.1.39078 WP_004550119.1.39179 WP_004550119.1.39595 WP_004550119.1.40275 WP_004550119.1.40388 WP_004550119.1.43373 WP_004550119.1.43587 WP_004550119.1.43786 WP_004550119.1.45284 WP_004550119.1.45537 WP_004550119.1.45715 WP_004550119.1.4631 WP_004550119.1.48093 WP_004550119.1.49872 WP_004550119.1.50174 WP_004550119.1.54369 WP_004550119.1.54804 WP_004550119.1.54859 WP_004550119.1.5608 WP_004550119.1.58355 WP_004550119.1.58509 WP_004550119.1.59103 WP_004550119.1.59200 WP_004550119.1.59747 WP_004550119.1.61202 WP_004550119.1.63261 WP_004550119.1.64364 WP_004550119.1.65468 WP_004550119.1.6835 WP_004550119.1.69022 WP_004550119.1.69770 WP_004550119.1.70278 WP_004550119.1.73418 WP_004550119.1.74569 WP_004550119.1.75075 WP_004550119.1.75913 WP_004550119.1.76142 WP_004550119.1.766 WP_004550119.1.77319 WP_004550119.1.77788 WP_004550119.1.79710 WP_004550119.1.79725 WP_004550119.1.81479 WP_004550119.1.82727 WP_004550119.1.83080 WP_004550119.1.83543 WP_004550119.1.83688 WP_004550119.1.84026 WP_004550119.1.85565 WP_004550119.1.856 WP_004550119.1.85774 WP_004550119.1.8629 WP_004550119.1.87652 WP_004550119.1.87759 WP_004550119.1.88237 WP_004550119.1.88369 WP_004550119.1.88666 WP_004550119.1.88764 WP_004550119.1.89240 WP_004550119.1.89435 WP_004550119.1.89782 WP_004550119.1.90471 WP_004550119.1.91025 WP_004550119.1.92406 WP_004550119.1.93845 WP_004550119.1.9479 WP_004550119.1.97989 WP_004550119.1.98316 WP_004550119.1.98753 WP_004550119.1.98768 WP_004550119.1.99069 WP_004550119.1.9962 357348.BURPS1106A_2929 gi|126453440|ref|YP_001067174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]