SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126453830|ref|YP_001065788.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126453830|ref|YP_001065788.1|
Domain Number 1 Region: 24-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.48e-96
Family Phosphate binding protein-like 0.00000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126453830|ref|YP_001065788.1|
Sequence length 342
Comment phosphate ABC transporter, periplasmic phosphate-binding protein PstS [Burkholderia pseudomallei 1106a]
Sequence
MKLMQTAFAGLAGALFAVAAHADITGAGSTFAMPIYTKWAADYQQSGGAKVNYQGIGSSG
GLKQIVAKTVDFAGSDAPLKDDELAKEGLFQFPTVVGGVVPVINVPGVKAGELTLSGAVL
GDIYLGKIKKWNDPAIAALNPKVKLPDTDIAVVRRADGSGTSFIWTNYLSKVNDEWKSKV
GEGTTVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKKNNMVYTALKNSTGTVVEPK
TETFKAAAAGANWSKSFYQILTNQPGKEAWPVVGATFVLLHAKQDKPAQGAETLKFFDWA
FKNGAKAADDLDYISLPASVETEIRKQWKVKVTDAAGKAVAE
Download sequence
Identical sequences A0A069B6I1 A0A0E1S3P4 A0A0E1TTZ4 A0A0E1UL09 A0A0E1W206 A0A0F6LGM0 A0A0H2WJ25 A0A290Y7Q1 A0A2K3FC73 A0A2K3GGS5 A0A2K3HHW8 A0A2K3I984 A2S3Q3 A3N857 A3NTW7 C4B473 C4KVI8 Q3JTT1 Q63V82
gi|403518218|ref|YP_006652351.1| WP_004199345.1.100104 WP_004199345.1.100195 WP_004199345.1.10047 WP_004199345.1.100583 WP_004199345.1.100727 WP_004199345.1.100825 WP_004199345.1.100900 WP_004199345.1.1010 WP_004199345.1.101060 WP_004199345.1.101307 WP_004199345.1.101381 WP_004199345.1.101559 WP_004199345.1.101588 WP_004199345.1.101783 WP_004199345.1.102051 WP_004199345.1.10269 WP_004199345.1.10290 WP_004199345.1.10359 WP_004199345.1.10553 WP_004199345.1.10633 WP_004199345.1.10746 WP_004199345.1.10907 WP_004199345.1.1098 WP_004199345.1.11046 WP_004199345.1.11072 WP_004199345.1.11404 WP_004199345.1.11747 WP_004199345.1.11825 WP_004199345.1.11893 WP_004199345.1.11996 WP_004199345.1.11998 WP_004199345.1.1266 WP_004199345.1.12731 WP_004199345.1.12793 WP_004199345.1.12856 WP_004199345.1.12860 WP_004199345.1.13198 WP_004199345.1.13309 WP_004199345.1.13504 WP_004199345.1.13520 WP_004199345.1.13597 WP_004199345.1.13603 WP_004199345.1.13639 WP_004199345.1.13925 WP_004199345.1.13950 WP_004199345.1.14356 WP_004199345.1.14539 WP_004199345.1.14557 WP_004199345.1.1465 WP_004199345.1.14660 WP_004199345.1.15170 WP_004199345.1.15673 WP_004199345.1.15696 WP_004199345.1.16090 WP_004199345.1.16113 WP_004199345.1.16249 WP_004199345.1.16358 WP_004199345.1.16540 WP_004199345.1.16561 WP_004199345.1.16625 WP_004199345.1.16680 WP_004199345.1.16689 WP_004199345.1.16749 WP_004199345.1.17067 WP_004199345.1.17068 WP_004199345.1.17278 WP_004199345.1.17473 WP_004199345.1.17748 WP_004199345.1.17786 WP_004199345.1.18058 WP_004199345.1.18396 WP_004199345.1.18405 WP_004199345.1.18471 WP_004199345.1.18549 WP_004199345.1.18631 WP_004199345.1.18669 WP_004199345.1.18704 WP_004199345.1.18744 WP_004199345.1.18868 WP_004199345.1.18906 WP_004199345.1.19401 WP_004199345.1.19486 WP_004199345.1.19540 WP_004199345.1.19629 WP_004199345.1.1976 WP_004199345.1.19815 WP_004199345.1.19842 WP_004199345.1.19854 WP_004199345.1.20021 WP_004199345.1.20246 WP_004199345.1.20501 WP_004199345.1.20520 WP_004199345.1.20531 WP_004199345.1.20673 WP_004199345.1.20954 WP_004199345.1.21291 WP_004199345.1.21304 WP_004199345.1.21409 WP_004199345.1.21442 WP_004199345.1.21461 WP_004199345.1.21653 WP_004199345.1.21809 WP_004199345.1.21907 WP_004199345.1.22046 WP_004199345.1.22299 WP_004199345.1.22308 WP_004199345.1.22329 WP_004199345.1.2261 WP_004199345.1.22625 WP_004199345.1.22779 WP_004199345.1.23009 WP_004199345.1.23086 WP_004199345.1.23104 WP_004199345.1.23131 WP_004199345.1.2317 WP_004199345.1.23385 WP_004199345.1.23743 WP_004199345.1.23852 WP_004199345.1.23994 WP_004199345.1.2404 WP_004199345.1.24134 WP_004199345.1.24314 WP_004199345.1.24372 WP_004199345.1.24454 WP_004199345.1.2462 WP_004199345.1.24701 WP_004199345.1.25068 WP_004199345.1.25102 WP_004199345.1.25138 WP_004199345.1.25265 WP_004199345.1.25412 WP_004199345.1.25628 WP_004199345.1.25728 WP_004199345.1.259 WP_004199345.1.26054 WP_004199345.1.26445 WP_004199345.1.26502 WP_004199345.1.26535 WP_004199345.1.26633 WP_004199345.1.26645 WP_004199345.1.267 WP_004199345.1.26838 WP_004199345.1.26849 WP_004199345.1.27064 WP_004199345.1.27069 WP_004199345.1.27146 WP_004199345.1.27363 WP_004199345.1.27390 WP_004199345.1.27399 WP_004199345.1.27420 WP_004199345.1.27441 WP_004199345.1.27597 WP_004199345.1.2767 WP_004199345.1.27909 WP_004199345.1.28018 WP_004199345.1.28066 WP_004199345.1.28187 WP_004199345.1.28453 WP_004199345.1.28594 WP_004199345.1.28619 WP_004199345.1.28632 WP_004199345.1.29148 WP_004199345.1.29161 WP_004199345.1.29178 WP_004199345.1.29335 WP_004199345.1.29405 WP_004199345.1.29508 WP_004199345.1.29520 WP_004199345.1.29853 WP_004199345.1.29878 WP_004199345.1.29887 WP_004199345.1.29948 WP_004199345.1.30311 WP_004199345.1.30382 WP_004199345.1.3041 WP_004199345.1.30671 WP_004199345.1.3069 WP_004199345.1.30729 WP_004199345.1.30937 WP_004199345.1.30966 WP_004199345.1.31343 WP_004199345.1.31831 WP_004199345.1.32174 WP_004199345.1.32182 WP_004199345.1.32221 WP_004199345.1.324 WP_004199345.1.3251 WP_004199345.1.32581 WP_004199345.1.3273 WP_004199345.1.32951 WP_004199345.1.33077 WP_004199345.1.33087 WP_004199345.1.33130 WP_004199345.1.33157 WP_004199345.1.33158 WP_004199345.1.33165 WP_004199345.1.332 WP_004199345.1.33366 WP_004199345.1.33419 WP_004199345.1.33543 WP_004199345.1.33573 WP_004199345.1.33779 WP_004199345.1.34230 WP_004199345.1.34333 WP_004199345.1.34393 WP_004199345.1.34564 WP_004199345.1.34747 WP_004199345.1.35025 WP_004199345.1.35052 WP_004199345.1.35090 WP_004199345.1.35141 WP_004199345.1.35227 WP_004199345.1.35249 WP_004199345.1.35485 WP_004199345.1.35491 WP_004199345.1.35757 WP_004199345.1.35825 WP_004199345.1.35878 WP_004199345.1.36106 WP_004199345.1.36174 WP_004199345.1.36259 WP_004199345.1.36527 WP_004199345.1.366 WP_004199345.1.36666 WP_004199345.1.36944 WP_004199345.1.37 WP_004199345.1.3706 WP_004199345.1.37373 WP_004199345.1.37428 WP_004199345.1.37446 WP_004199345.1.37517 WP_004199345.1.37519 WP_004199345.1.37581 WP_004199345.1.37622 WP_004199345.1.37627 WP_004199345.1.37690 WP_004199345.1.37702 WP_004199345.1.37725 WP_004199345.1.37806 WP_004199345.1.37934 WP_004199345.1.37959 WP_004199345.1.38115 WP_004199345.1.38442 WP_004199345.1.38490 WP_004199345.1.38683 WP_004199345.1.3872 WP_004199345.1.38810 WP_004199345.1.38946 WP_004199345.1.39078 WP_004199345.1.39162 WP_004199345.1.39179 WP_004199345.1.39349 WP_004199345.1.3947 WP_004199345.1.39595 WP_004199345.1.39757 WP_004199345.1.39898 WP_004199345.1.40021 WP_004199345.1.40045 WP_004199345.1.40191 WP_004199345.1.40235 WP_004199345.1.40275 WP_004199345.1.40388 WP_004199345.1.40390 WP_004199345.1.40426 WP_004199345.1.4077 WP_004199345.1.41477 WP_004199345.1.41588 WP_004199345.1.41945 WP_004199345.1.42408 WP_004199345.1.42492 WP_004199345.1.42496 WP_004199345.1.42800 WP_004199345.1.43136 WP_004199345.1.43156 WP_004199345.1.43373 WP_004199345.1.43542 WP_004199345.1.43587 WP_004199345.1.43678 WP_004199345.1.43727 WP_004199345.1.43786 WP_004199345.1.43899 WP_004199345.1.44179 WP_004199345.1.44234 WP_004199345.1.44352 WP_004199345.1.44540 WP_004199345.1.44824 WP_004199345.1.45284 WP_004199345.1.45348 WP_004199345.1.45356 WP_004199345.1.45537 WP_004199345.1.45715 WP_004199345.1.45890 WP_004199345.1.4631 WP_004199345.1.46575 WP_004199345.1.46757 WP_004199345.1.46829 WP_004199345.1.4693 WP_004199345.1.46969 WP_004199345.1.47086 WP_004199345.1.47149 WP_004199345.1.4718 WP_004199345.1.47564 WP_004199345.1.48093 WP_004199345.1.4810 WP_004199345.1.48165 WP_004199345.1.48313 WP_004199345.1.48407 WP_004199345.1.48464 WP_004199345.1.49872 WP_004199345.1.50174 WP_004199345.1.50320 WP_004199345.1.50336 WP_004199345.1.50401 WP_004199345.1.50636 WP_004199345.1.50788 WP_004199345.1.50839 WP_004199345.1.5105 WP_004199345.1.51606 WP_004199345.1.51666 WP_004199345.1.5173 WP_004199345.1.5182 WP_004199345.1.51874 WP_004199345.1.51891 WP_004199345.1.51902 WP_004199345.1.52229 WP_004199345.1.52365 WP_004199345.1.52407 WP_004199345.1.52451 WP_004199345.1.52521 WP_004199345.1.52643 WP_004199345.1.52655 WP_004199345.1.52760 WP_004199345.1.52882 WP_004199345.1.5292 WP_004199345.1.53034 WP_004199345.1.53048 WP_004199345.1.53132 WP_004199345.1.53282 WP_004199345.1.5338 WP_004199345.1.53386 WP_004199345.1.53506 WP_004199345.1.53578 WP_004199345.1.53977 WP_004199345.1.54016 WP_004199345.1.5413 WP_004199345.1.54312 WP_004199345.1.54369 WP_004199345.1.54804 WP_004199345.1.54859 WP_004199345.1.54892 WP_004199345.1.55038 WP_004199345.1.55415 WP_004199345.1.55691 WP_004199345.1.55755 WP_004199345.1.55996 WP_004199345.1.5608 WP_004199345.1.56126 WP_004199345.1.56248 WP_004199345.1.56451 WP_004199345.1.56458 WP_004199345.1.56591 WP_004199345.1.56744 WP_004199345.1.56949 WP_004199345.1.56993 WP_004199345.1.57046 WP_004199345.1.57096 WP_004199345.1.57247 WP_004199345.1.5734 WP_004199345.1.57359 WP_004199345.1.57679 WP_004199345.1.5776 WP_004199345.1.58003 WP_004199345.1.58105 WP_004199345.1.58190 WP_004199345.1.58355 WP_004199345.1.58362 WP_004199345.1.58390 WP_004199345.1.58405 WP_004199345.1.58509 WP_004199345.1.58523 WP_004199345.1.58578 WP_004199345.1.58639 WP_004199345.1.58758 WP_004199345.1.5883 WP_004199345.1.59103 WP_004199345.1.59200 WP_004199345.1.59255 WP_004199345.1.59422 WP_004199345.1.59496 WP_004199345.1.59519 WP_004199345.1.59536 WP_004199345.1.59549 WP_004199345.1.59747 WP_004199345.1.60398 WP_004199345.1.60769 WP_004199345.1.60810 WP_004199345.1.60833 WP_004199345.1.60836 WP_004199345.1.60969 WP_004199345.1.61073 WP_004199345.1.61084 WP_004199345.1.61202 WP_004199345.1.61455 WP_004199345.1.61588 WP_004199345.1.61685 WP_004199345.1.61854 WP_004199345.1.61900 WP_004199345.1.62103 WP_004199345.1.62183 WP_004199345.1.62774 WP_004199345.1.63261 WP_004199345.1.63361 WP_004199345.1.63379 WP_004199345.1.63439 WP_004199345.1.63505 WP_004199345.1.63661 WP_004199345.1.63719 WP_004199345.1.64068 WP_004199345.1.64096 WP_004199345.1.64166 WP_004199345.1.64204 WP_004199345.1.64364 WP_004199345.1.64383 WP_004199345.1.64542 WP_004199345.1.64683 WP_004199345.1.64892 WP_004199345.1.65270 WP_004199345.1.65468 WP_004199345.1.65832 WP_004199345.1.65994 WP_004199345.1.66257 WP_004199345.1.66321 WP_004199345.1.66380 WP_004199345.1.66465 WP_004199345.1.66594 WP_004199345.1.67013 WP_004199345.1.67182 WP_004199345.1.67229 WP_004199345.1.67393 WP_004199345.1.6765 WP_004199345.1.67860 WP_004199345.1.67909 WP_004199345.1.67914 WP_004199345.1.67978 WP_004199345.1.6835 WP_004199345.1.68515 WP_004199345.1.68664 WP_004199345.1.68886 WP_004199345.1.68922 WP_004199345.1.69022 WP_004199345.1.69081 WP_004199345.1.69094 WP_004199345.1.69106 WP_004199345.1.69169 WP_004199345.1.69217 WP_004199345.1.69354 WP_004199345.1.69508 WP_004199345.1.69770 WP_004199345.1.69918 WP_004199345.1.70016 WP_004199345.1.70096 WP_004199345.1.70278 WP_004199345.1.70280 WP_004199345.1.70735 WP_004199345.1.71392 WP_004199345.1.71901 WP_004199345.1.72015 WP_004199345.1.72083 WP_004199345.1.72545 WP_004199345.1.72798 WP_004199345.1.72817 WP_004199345.1.73317 WP_004199345.1.73418 WP_004199345.1.73521 WP_004199345.1.73576 WP_004199345.1.73906 WP_004199345.1.73974 WP_004199345.1.74177 WP_004199345.1.74425 WP_004199345.1.7450 WP_004199345.1.74569 WP_004199345.1.74675 WP_004199345.1.75001 WP_004199345.1.75027 WP_004199345.1.75075 WP_004199345.1.75230 WP_004199345.1.75276 WP_004199345.1.75519 WP_004199345.1.75677 WP_004199345.1.75708 WP_004199345.1.75711 WP_004199345.1.75776 WP_004199345.1.75861 WP_004199345.1.75883 WP_004199345.1.75913 WP_004199345.1.76142 WP_004199345.1.76290 WP_004199345.1.76432 WP_004199345.1.76522 WP_004199345.1.76575 WP_004199345.1.766 WP_004199345.1.7703 WP_004199345.1.77287 WP_004199345.1.77319 WP_004199345.1.77689 WP_004199345.1.77788 WP_004199345.1.77845 WP_004199345.1.78029 WP_004199345.1.78278 WP_004199345.1.78506 WP_004199345.1.78557 WP_004199345.1.78759 WP_004199345.1.78807 WP_004199345.1.78827 WP_004199345.1.79052 WP_004199345.1.79360 WP_004199345.1.795 WP_004199345.1.79653 WP_004199345.1.79689 WP_004199345.1.79710 WP_004199345.1.79725 WP_004199345.1.79782 WP_004199345.1.80098 WP_004199345.1.80395 WP_004199345.1.80433 WP_004199345.1.80614 WP_004199345.1.81042 WP_004199345.1.8126 WP_004199345.1.81479 WP_004199345.1.81511 WP_004199345.1.81543 WP_004199345.1.82197 WP_004199345.1.82283 WP_004199345.1.82323 WP_004199345.1.82394 WP_004199345.1.82506 WP_004199345.1.82575 WP_004199345.1.82694 WP_004199345.1.82727 WP_004199345.1.82915 WP_004199345.1.82950 WP_004199345.1.83080 WP_004199345.1.83357 WP_004199345.1.8341 WP_004199345.1.83487 WP_004199345.1.83543 WP_004199345.1.83567 WP_004199345.1.83688 WP_004199345.1.8388 WP_004199345.1.8390 WP_004199345.1.8395 WP_004199345.1.83967 WP_004199345.1.84002 WP_004199345.1.84026 WP_004199345.1.84063 WP_004199345.1.84181 WP_004199345.1.84375 WP_004199345.1.84379 WP_004199345.1.84480 WP_004199345.1.84654 WP_004199345.1.84866 WP_004199345.1.85170 WP_004199345.1.85412 WP_004199345.1.85443 WP_004199345.1.85467 WP_004199345.1.85490 WP_004199345.1.85565 WP_004199345.1.85584 WP_004199345.1.856 WP_004199345.1.85641 WP_004199345.1.85645 WP_004199345.1.85774 WP_004199345.1.8585 WP_004199345.1.8629 WP_004199345.1.86295 WP_004199345.1.86438 WP_004199345.1.86525 WP_004199345.1.86806 WP_004199345.1.86872 WP_004199345.1.8697 WP_004199345.1.87114 WP_004199345.1.87278 WP_004199345.1.87553 WP_004199345.1.87652 WP_004199345.1.87759 WP_004199345.1.87811 WP_004199345.1.88003 WP_004199345.1.88117 WP_004199345.1.88168 WP_004199345.1.88237 WP_004199345.1.88322 WP_004199345.1.88369 WP_004199345.1.88666 WP_004199345.1.88682 WP_004199345.1.88764 WP_004199345.1.88920 WP_004199345.1.89093 WP_004199345.1.8912 WP_004199345.1.89240 WP_004199345.1.89435 WP_004199345.1.89514 WP_004199345.1.89782 WP_004199345.1.90079 WP_004199345.1.90471 WP_004199345.1.9079 WP_004199345.1.90934 WP_004199345.1.91025 WP_004199345.1.91142 WP_004199345.1.91198 WP_004199345.1.91700 WP_004199345.1.91709 WP_004199345.1.91763 WP_004199345.1.91823 WP_004199345.1.92095 WP_004199345.1.9236 WP_004199345.1.92367 WP_004199345.1.92406 WP_004199345.1.92493 WP_004199345.1.92507 WP_004199345.1.9280 WP_004199345.1.9281 WP_004199345.1.92904 WP_004199345.1.93844 WP_004199345.1.93845 WP_004199345.1.94023 WP_004199345.1.94050 WP_004199345.1.94117 WP_004199345.1.94121 WP_004199345.1.94286 WP_004199345.1.94403 WP_004199345.1.94498 WP_004199345.1.94520 WP_004199345.1.9479 WP_004199345.1.94926 WP_004199345.1.95054 WP_004199345.1.95339 WP_004199345.1.9537 WP_004199345.1.95420 WP_004199345.1.95672 WP_004199345.1.95938 WP_004199345.1.95952 WP_004199345.1.96381 WP_004199345.1.96660 WP_004199345.1.97058 WP_004199345.1.97148 WP_004199345.1.97989 WP_004199345.1.98066 WP_004199345.1.98218 WP_004199345.1.98316 WP_004199345.1.98491 WP_004199345.1.98547 WP_004199345.1.98688 WP_004199345.1.98713 WP_004199345.1.98753 WP_004199345.1.98768 WP_004199345.1.98944 WP_004199345.1.99061 WP_004199345.1.99069 WP_004199345.1.99233 WP_004199345.1.9962 WP_004199345.1.99741 WP_004199345.1.9975 WP_004199345.1.9983 WP_004199345.1.99919 YP_102543.1.87047 YP_107984.1.59693 gi|76810546|ref|YP_333022.1| gi|53725542|ref|YP_102543.1| gi|53718998|ref|YP_107984.1| gi|126440274|ref|YP_001058528.1| 243160.BMA0780 272560.BPSL1359 320372.BURPS1710b_1618 320373.BURPS668_1485 320388.BMASAVP1_A1291 320389.BMA10247_0574 357348.BURPS1106A_1515 412022.BMA10229_A0577 536230.GBP346_A1520 gi|237811782|ref|YP_002896233.1| gi|124386069|ref|YP_001026572.1| gi|556577197|ref|YP_008742767.1| gi|121600135|ref|YP_992626.1| gi|126450716|ref|YP_001080143.1| gi|126453830|ref|YP_001065788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]