SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126454390|ref|YP_001068256.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126454390|ref|YP_001068256.1|
Domain Number 1 Region: 1-260
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.9e-51
Family Phosphate binding protein-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126454390|ref|YP_001068256.1|
Sequence length 261
Comment cyclohexadienyl dehydratase [Burkholderia pseudomallei 1106a]
Sequence
MKMNQTLLALACCAGLAHAQTAPQPGAPASRLDDVLARGTLRVCTTGDYKPYTYRREDGA
FEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGGISTTLERQKRVFFTQP
YVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFAKQHFTRAKLTVFPDNVT
IFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFGEKAYMVPRGDVVFQQYVD
QWLHLARETGELRAISDKWLK
Download sequence
Identical sequences A0A0E1S7B8 A0A0E1TST0 A0A0E1W9E5 A0A0F6GI95 A0A0F6L6K6 A0A0H3HQQ0 A0A1S0SBI0 A0A2K3FD48 A0A2K3GAM5 A0A2K3HJT9 A0A2K3IA20 A3NF36 A3P0Y5 A8EGR8 B1H9Z4 C4KY87 Q3JXW5 Q63PI4
gi|126454390|ref|YP_001068256.1| gi|526471130|ref|YP_008342139.1| gi|76811465|ref|YP_331588.1| gi|403520672|ref|YP_006654806.1| gi|237814340|ref|YP_002898791.1| gi|126440444|ref|YP_001060957.1| gi|386863691|ref|YP_006276640.1| gi|53720999|ref|YP_109985.1| WP_004525749.1.100195 WP_004525749.1.100583 WP_004525749.1.100720 WP_004525749.1.100825 WP_004525749.1.100900 WP_004525749.1.1010 WP_004525749.1.101307 WP_004525749.1.101381 WP_004525749.1.101559 WP_004525749.1.101588 WP_004525749.1.101783 WP_004525749.1.102051 WP_004525749.1.10359 WP_004525749.1.10553 WP_004525749.1.10633 WP_004525749.1.10746 WP_004525749.1.10907 WP_004525749.1.11046 WP_004525749.1.11072 WP_004525749.1.11160 WP_004525749.1.11268 WP_004525749.1.11404 WP_004525749.1.11996 WP_004525749.1.1266 WP_004525749.1.12731 WP_004525749.1.12856 WP_004525749.1.13309 WP_004525749.1.13504 WP_004525749.1.13520 WP_004525749.1.13597 WP_004525749.1.13639 WP_004525749.1.14539 WP_004525749.1.1465 WP_004525749.1.14660 WP_004525749.1.15170 WP_004525749.1.15364 WP_004525749.1.15525 WP_004525749.1.15673 WP_004525749.1.15696 WP_004525749.1.16090 WP_004525749.1.16249 WP_004525749.1.16358 WP_004525749.1.16561 WP_004525749.1.16625 WP_004525749.1.16680 WP_004525749.1.16689 WP_004525749.1.16749 WP_004525749.1.17067 WP_004525749.1.17068 WP_004525749.1.17278 WP_004525749.1.17473 WP_004525749.1.17786 WP_004525749.1.18058 WP_004525749.1.18405 WP_004525749.1.18631 WP_004525749.1.18744 WP_004525749.1.18868 WP_004525749.1.18906 WP_004525749.1.19486 WP_004525749.1.19540 WP_004525749.1.19629 WP_004525749.1.1976 WP_004525749.1.19815 WP_004525749.1.19842 WP_004525749.1.19854 WP_004525749.1.20021 WP_004525749.1.20246 WP_004525749.1.20520 WP_004525749.1.20673 WP_004525749.1.21147 WP_004525749.1.21205 WP_004525749.1.21291 WP_004525749.1.21304 WP_004525749.1.21653 WP_004525749.1.21809 WP_004525749.1.21907 WP_004525749.1.22046 WP_004525749.1.22299 WP_004525749.1.2261 WP_004525749.1.22779 WP_004525749.1.23086 WP_004525749.1.23104 WP_004525749.1.23852 WP_004525749.1.23994 WP_004525749.1.24020 WP_004525749.1.2404 WP_004525749.1.24134 WP_004525749.1.24314 WP_004525749.1.24454 WP_004525749.1.24513 WP_004525749.1.2462 WP_004525749.1.25068 WP_004525749.1.25265 WP_004525749.1.25412 WP_004525749.1.25628 WP_004525749.1.259 WP_004525749.1.26054 WP_004525749.1.26502 WP_004525749.1.26535 WP_004525749.1.26565 WP_004525749.1.26633 WP_004525749.1.26645 WP_004525749.1.267 WP_004525749.1.26838 WP_004525749.1.26849 WP_004525749.1.27064 WP_004525749.1.27069 WP_004525749.1.27363 WP_004525749.1.27390 WP_004525749.1.27420 WP_004525749.1.27597 WP_004525749.1.2767 WP_004525749.1.27810 WP_004525749.1.28018 WP_004525749.1.28187 WP_004525749.1.29161 WP_004525749.1.29178 WP_004525749.1.29335 WP_004525749.1.29508 WP_004525749.1.29520 WP_004525749.1.29547 WP_004525749.1.29658 WP_004525749.1.29853 WP_004525749.1.29878 WP_004525749.1.29887 WP_004525749.1.29899 WP_004525749.1.29948 WP_004525749.1.30311 WP_004525749.1.3041 WP_004525749.1.30671 WP_004525749.1.3069 WP_004525749.1.30729 WP_004525749.1.30937 WP_004525749.1.31343 WP_004525749.1.31723 WP_004525749.1.32182 WP_004525749.1.32221 WP_004525749.1.324 WP_004525749.1.32581 WP_004525749.1.3273 WP_004525749.1.32951 WP_004525749.1.33157 WP_004525749.1.33158 WP_004525749.1.332 WP_004525749.1.33366 WP_004525749.1.33493 WP_004525749.1.33573 WP_004525749.1.33779 WP_004525749.1.34230 WP_004525749.1.34333 WP_004525749.1.34393 WP_004525749.1.35025 WP_004525749.1.35052 WP_004525749.1.35090 WP_004525749.1.35141 WP_004525749.1.35227 WP_004525749.1.35249 WP_004525749.1.35474 WP_004525749.1.35485 WP_004525749.1.35491 WP_004525749.1.35825 WP_004525749.1.36527 WP_004525749.1.36662 WP_004525749.1.36666 WP_004525749.1.37 WP_004525749.1.3706 WP_004525749.1.37373 WP_004525749.1.37428 WP_004525749.1.37446 WP_004525749.1.37517 WP_004525749.1.37519 WP_004525749.1.37535 WP_004525749.1.37581 WP_004525749.1.37622 WP_004525749.1.37627 WP_004525749.1.37690 WP_004525749.1.37702 WP_004525749.1.37725 WP_004525749.1.37934 WP_004525749.1.37959 WP_004525749.1.37994 WP_004525749.1.38115 WP_004525749.1.38442 WP_004525749.1.38490 WP_004525749.1.38683 WP_004525749.1.39078 WP_004525749.1.39162 WP_004525749.1.3947 WP_004525749.1.39595 WP_004525749.1.39757 WP_004525749.1.39898 WP_004525749.1.40235 WP_004525749.1.40275 WP_004525749.1.40388 WP_004525749.1.40390 WP_004525749.1.40426 WP_004525749.1.40448 WP_004525749.1.41945 WP_004525749.1.42408 WP_004525749.1.42492 WP_004525749.1.42496 WP_004525749.1.43136 WP_004525749.1.43156 WP_004525749.1.43542 WP_004525749.1.43587 WP_004525749.1.43727 WP_004525749.1.43786 WP_004525749.1.44179 WP_004525749.1.44234 WP_004525749.1.44352 WP_004525749.1.44414 WP_004525749.1.44824 WP_004525749.1.45284 WP_004525749.1.45356 WP_004525749.1.45537 WP_004525749.1.45715 WP_004525749.1.4631 WP_004525749.1.46575 WP_004525749.1.46757 WP_004525749.1.46829 WP_004525749.1.4693 WP_004525749.1.46969 WP_004525749.1.47086 WP_004525749.1.47149 WP_004525749.1.47564 WP_004525749.1.48093 WP_004525749.1.48464 WP_004525749.1.49717 WP_004525749.1.49872 WP_004525749.1.50174 WP_004525749.1.50336 WP_004525749.1.50401 WP_004525749.1.50636 WP_004525749.1.50788 WP_004525749.1.50839 WP_004525749.1.51606 WP_004525749.1.51666 WP_004525749.1.5182 WP_004525749.1.51874 WP_004525749.1.51891 WP_004525749.1.52229 WP_004525749.1.52365 WP_004525749.1.52451 WP_004525749.1.52521 WP_004525749.1.52547 WP_004525749.1.52643 WP_004525749.1.52655 WP_004525749.1.52731 WP_004525749.1.52882 WP_004525749.1.5292 WP_004525749.1.53034 WP_004525749.1.53048 WP_004525749.1.53103 WP_004525749.1.53132 WP_004525749.1.53282 WP_004525749.1.5338 WP_004525749.1.53386 WP_004525749.1.53506 WP_004525749.1.53578 WP_004525749.1.54016 WP_004525749.1.54369 WP_004525749.1.54804 WP_004525749.1.55038 WP_004525749.1.55691 WP_004525749.1.55755 WP_004525749.1.5608 WP_004525749.1.56126 WP_004525749.1.56248 WP_004525749.1.5641 WP_004525749.1.56451 WP_004525749.1.56591 WP_004525749.1.56744 WP_004525749.1.56949 WP_004525749.1.56993 WP_004525749.1.57046 WP_004525749.1.57096 WP_004525749.1.57247 WP_004525749.1.57341 WP_004525749.1.5776 WP_004525749.1.58003 WP_004525749.1.58105 WP_004525749.1.58190 WP_004525749.1.58362 WP_004525749.1.58405 WP_004525749.1.58578 WP_004525749.1.58639 WP_004525749.1.59103 WP_004525749.1.59200 WP_004525749.1.59255 WP_004525749.1.59422 WP_004525749.1.59549 WP_004525749.1.59747 WP_004525749.1.60398 WP_004525749.1.60810 WP_004525749.1.60833 WP_004525749.1.60836 WP_004525749.1.61084 WP_004525749.1.61202 WP_004525749.1.61455 WP_004525749.1.61685 WP_004525749.1.61723 WP_004525749.1.6186 WP_004525749.1.62183 WP_004525749.1.62774 WP_004525749.1.63097 WP_004525749.1.63261 WP_004525749.1.63379 WP_004525749.1.63439 WP_004525749.1.63505 WP_004525749.1.63719 WP_004525749.1.63942 WP_004525749.1.64068 WP_004525749.1.64096 WP_004525749.1.64166 WP_004525749.1.64204 WP_004525749.1.64364 WP_004525749.1.64383 WP_004525749.1.64542 WP_004525749.1.65093 WP_004525749.1.65270 WP_004525749.1.65468 WP_004525749.1.65832 WP_004525749.1.65994 WP_004525749.1.66257 WP_004525749.1.66321 WP_004525749.1.67013 WP_004525749.1.67117 WP_004525749.1.67182 WP_004525749.1.67229 WP_004525749.1.67559 WP_004525749.1.6765 WP_004525749.1.67860 WP_004525749.1.67914 WP_004525749.1.6835 WP_004525749.1.68353 WP_004525749.1.68515 WP_004525749.1.68664 WP_004525749.1.68886 WP_004525749.1.69022 WP_004525749.1.69081 WP_004525749.1.69094 WP_004525749.1.69106 WP_004525749.1.69169 WP_004525749.1.69354 WP_004525749.1.69770 WP_004525749.1.69918 WP_004525749.1.70016 WP_004525749.1.7006 WP_004525749.1.70066 WP_004525749.1.70096 WP_004525749.1.70278 WP_004525749.1.71392 WP_004525749.1.71444 WP_004525749.1.71564 WP_004525749.1.71901 WP_004525749.1.72015 WP_004525749.1.72083 WP_004525749.1.72817 WP_004525749.1.73317 WP_004525749.1.73418 WP_004525749.1.73521 WP_004525749.1.73576 WP_004525749.1.73906 WP_004525749.1.73974 WP_004525749.1.74177 WP_004525749.1.74425 WP_004525749.1.74569 WP_004525749.1.74690 WP_004525749.1.75001 WP_004525749.1.75027 WP_004525749.1.75075 WP_004525749.1.75519 WP_004525749.1.75708 WP_004525749.1.75711 WP_004525749.1.75776 WP_004525749.1.75913 WP_004525749.1.75937 WP_004525749.1.76142 WP_004525749.1.76290 WP_004525749.1.76432 WP_004525749.1.76522 WP_004525749.1.76575 WP_004525749.1.766 WP_004525749.1.7703 WP_004525749.1.77249 WP_004525749.1.77287 WP_004525749.1.77319 WP_004525749.1.77689 WP_004525749.1.77788 WP_004525749.1.78628 WP_004525749.1.78759 WP_004525749.1.78807 WP_004525749.1.78827 WP_004525749.1.79052 WP_004525749.1.79360 WP_004525749.1.795 WP_004525749.1.79689 WP_004525749.1.79710 WP_004525749.1.79782 WP_004525749.1.80302 WP_004525749.1.80433 WP_004525749.1.80614 WP_004525749.1.80923 WP_004525749.1.81479 WP_004525749.1.81543 WP_004525749.1.82323 WP_004525749.1.82394 WP_004525749.1.82506 WP_004525749.1.82694 WP_004525749.1.82727 WP_004525749.1.82915 WP_004525749.1.82950 WP_004525749.1.83080 WP_004525749.1.83357 WP_004525749.1.83487 WP_004525749.1.83543 WP_004525749.1.83567 WP_004525749.1.83609 WP_004525749.1.83688 WP_004525749.1.8388 WP_004525749.1.8390 WP_004525749.1.83967 WP_004525749.1.84026 WP_004525749.1.84379 WP_004525749.1.84866 WP_004525749.1.85170 WP_004525749.1.85412 WP_004525749.1.85467 WP_004525749.1.85490 WP_004525749.1.85565 WP_004525749.1.85584 WP_004525749.1.856 WP_004525749.1.85641 WP_004525749.1.85645 WP_004525749.1.8629 WP_004525749.1.86525 WP_004525749.1.86806 WP_004525749.1.86872 WP_004525749.1.87114 WP_004525749.1.87278 WP_004525749.1.87324 WP_004525749.1.87759 WP_004525749.1.87811 WP_004525749.1.88003 WP_004525749.1.88117 WP_004525749.1.88237 WP_004525749.1.88322 WP_004525749.1.88369 WP_004525749.1.88666 WP_004525749.1.88682 WP_004525749.1.88764 WP_004525749.1.88920 WP_004525749.1.89093 WP_004525749.1.8912 WP_004525749.1.89240 WP_004525749.1.89435 WP_004525749.1.89514 WP_004525749.1.89782 WP_004525749.1.90079 WP_004525749.1.90471 WP_004525749.1.9079 WP_004525749.1.90934 WP_004525749.1.91025 WP_004525749.1.91142 WP_004525749.1.91709 WP_004525749.1.91823 WP_004525749.1.92095 WP_004525749.1.92367 WP_004525749.1.92406 WP_004525749.1.92430 WP_004525749.1.92493 WP_004525749.1.92507 WP_004525749.1.9280 WP_004525749.1.93844 WP_004525749.1.94023 WP_004525749.1.94117 WP_004525749.1.94121 WP_004525749.1.94286 WP_004525749.1.94403 WP_004525749.1.94498 WP_004525749.1.94520 WP_004525749.1.9479 WP_004525749.1.94901 WP_004525749.1.94926 WP_004525749.1.95054 WP_004525749.1.95300 WP_004525749.1.95339 WP_004525749.1.95420 WP_004525749.1.95587 WP_004525749.1.95644 WP_004525749.1.95672 WP_004525749.1.97058 WP_004525749.1.97112 WP_004525749.1.97148 WP_004525749.1.97989 WP_004525749.1.98218 WP_004525749.1.98316 WP_004525749.1.98491 WP_004525749.1.98547 WP_004525749.1.98688 WP_004525749.1.99061 WP_004525749.1.99069 WP_004525749.1.99160 WP_004525749.1.99233 WP_004525749.1.9962 WP_004525749.1.99629 WP_004525749.1.99741 WP_004525749.1.9975 YP_109985.1.59693 272560.BPSL3392 320372.BURPS1710b_0172 320373.BURPS668_3964 357348.BURPS1106A_4037 536230.GBP346_A4138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]