SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126454396|ref|YP_001065692.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126454396|ref|YP_001065692.1|
Domain Number 1 Region: 42-342
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.36e-66
Family Phosphate binding protein-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126454396|ref|YP_001065692.1|
Sequence length 353
Comment ABC transporter substrate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MTVRRSLLPRSPLAAVRRACAAMLIPVASLALSLGASAAHAQDTAICYNCPPEWADWAAQ
IAAIKQRTGIRVPFDNKNSGQAIAQLIAEQKSPVADVVYLGVSSAFQAKDKGVVAPYKPA
HWSDIPANLKDPQGYWFAIHSGTLGFFVNKDALDGKPVPRTWADLLKPEYKGMVGYLDPS
SAFVGYAGAVAVNQALGGSFDDFRPALDWFRKLKANQPIVPKQTAYARVLSGEIPILLDY
DFDAYRAKYKDHANVEFVIPKEGTISVPYVMSLVKGAPHEANGRKVLDFVLSDEGQKLWA
SAYLRPVRAQALGADVAAQFLPASEYARAKSVDFGKLAAGQQAFGKQYLQAMQ
Download sequence
Identical sequences A0A095RPH9 A0A0E1S0S6 A0A0E1TZH7 A0A0F6LGJ6 A0A2K3FCD1 A0A2K3G0Y0 A0A2K3HI17 A0A2K3I9I0 A3NTM1 Q63VE1
272560.BPSL1303 357348.BURPS1106A_1419 gi|53718939|ref|YP_107925.1| gi|126454396|ref|YP_001065692.1| gi|403518121|ref|YP_006652254.1| WP_004535535.1.101060 WP_004535535.1.1098 WP_004535535.1.11072 WP_004535535.1.13198 WP_004535535.1.13603 WP_004535535.1.13639 WP_004535535.1.1465 WP_004535535.1.16249 WP_004535535.1.16680 WP_004535535.1.16689 WP_004535535.1.21409 WP_004535535.1.22779 WP_004535535.1.25265 WP_004535535.1.259 WP_004535535.1.27069 WP_004535535.1.27441 WP_004535535.1.29335 WP_004535535.1.29853 WP_004535535.1.29887 WP_004535535.1.30311 WP_004535535.1.30382 WP_004535535.1.30671 WP_004535535.1.30966 WP_004535535.1.33157 WP_004535535.1.34230 WP_004535535.1.35052 WP_004535535.1.36666 WP_004535535.1.36944 WP_004535535.1.38490 WP_004535535.1.3872 WP_004535535.1.39162 WP_004535535.1.39179 WP_004535535.1.39757 WP_004535535.1.42800 WP_004535535.1.43136 WP_004535535.1.43786 WP_004535535.1.46757 WP_004535535.1.48464 WP_004535535.1.52229 WP_004535535.1.52451 WP_004535535.1.52643 WP_004535535.1.53048 WP_004535535.1.53506 WP_004535535.1.54016 WP_004535535.1.5413 WP_004535535.1.54859 WP_004535535.1.55691 WP_004535535.1.55755 WP_004535535.1.55996 WP_004535535.1.5608 WP_004535535.1.57247 WP_004535535.1.58390 WP_004535535.1.58509 WP_004535535.1.59422 WP_004535535.1.60810 WP_004535535.1.61084 WP_004535535.1.63439 WP_004535535.1.63505 WP_004535535.1.66321 WP_004535535.1.66465 WP_004535535.1.67860 WP_004535535.1.67909 WP_004535535.1.68515 WP_004535535.1.68886 WP_004535535.1.69106 WP_004535535.1.69169 WP_004535535.1.70278 WP_004535535.1.71901 WP_004535535.1.72817 WP_004535535.1.73906 WP_004535535.1.74425 WP_004535535.1.75276 WP_004535535.1.75711 WP_004535535.1.75883 WP_004535535.1.76142 WP_004535535.1.76522 WP_004535535.1.766 WP_004535535.1.77689 WP_004535535.1.80433 WP_004535535.1.83688 WP_004535535.1.8390 WP_004535535.1.83967 WP_004535535.1.84026 WP_004535535.1.84375 WP_004535535.1.85412 WP_004535535.1.85490 WP_004535535.1.85645 WP_004535535.1.8585 WP_004535535.1.86525 WP_004535535.1.86806 WP_004535535.1.87114 WP_004535535.1.87278 WP_004535535.1.87811 WP_004535535.1.88237 WP_004535535.1.89093 WP_004535535.1.89514 WP_004535535.1.90934 WP_004535535.1.91025 WP_004535535.1.92507 WP_004535535.1.92904 WP_004535535.1.94117 WP_004535535.1.94520 WP_004535535.1.97148 WP_004535535.1.98547 WP_004535535.1.98768 WP_004535535.1.9983 WP_004535535.1.99890 YP_107925.1.59693 gi|526471905|ref|YP_008340888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]