SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126454996|ref|YP_001065655.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126454996|ref|YP_001065655.1|
Domain Number 1 Region: 33-348
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.56e-74
Family Phosphate binding protein-like 0.000000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126454996|ref|YP_001065655.1|
Sequence length 351
Comment iron ABC transporter substrate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MFVKQARPLLRTLLRPLAFAFALAAVAPAAHAANEVNLYTTREPKLIQPLVDAFTKQSGI
AVNTVFVKDGLLERVKAEGARSPADVLMTVDIGNLLDLVDGGLTQPVRSASLDGAIPANL
RGAGGNWYALSLRDRVLYVDKNMQLDAITYESLADPKWKGKVCVRSGQHPYNTALVAAMI
AHDGEAAAEQWLRGVKANLARKATGGDRDVARDILGGICDIGLANAYYAGHMKHAQPGTD
ARKWGDAIKVVRPTFANAKSGGTHVNVSGAAVAKHAPNRDNAVKLLEYLASPPAQALYAQ
ANYEYPVRAGVALDPVIAGFGPLKVDPLPLVEIAKYRKRASQLVDKVGFDN
Download sequence
Identical sequences A0A095RQR5 A0A0E1TU11 A0A0E1UG83 A0A0H2WFU1 A0A0H3HPQ4 A0A290YA32 A0A2K3FDC1 A0A2K3G0Z5 A0A2K3HI45 A0A2K3I9J2 A3N7V0 A3NTI4 A8EF41 B1HHK5 C4B338 C4KUT6
gi|53724203|ref|YP_103391.1| gi|386862324|ref|YP_006275273.1| gi|403518083|ref|YP_006652216.1| gi|126439072|ref|YP_001058421.1| gi|237811665|ref|YP_002896116.1| gi|126454996|ref|YP_001065655.1| 243160.BMA1777 320373.BURPS668_1378 320388.BMASAVP1_A1182 357348.BURPS1106A_1382 536230.GBP346_A1402 gi|121601360|ref|YP_992517.1| WP_004191691.1.100104 WP_004191691.1.100195 WP_004191691.1.10047 WP_004191691.1.100583 WP_004191691.1.100825 WP_004191691.1.100900 WP_004191691.1.101060 WP_004191691.1.101307 WP_004191691.1.101783 WP_004191691.1.102051 WP_004191691.1.10269 WP_004191691.1.10290 WP_004191691.1.10359 WP_004191691.1.10746 WP_004191691.1.10907 WP_004191691.1.11046 WP_004191691.1.11072 WP_004191691.1.11825 WP_004191691.1.11996 WP_004191691.1.11998 WP_004191691.1.12731 WP_004191691.1.12793 WP_004191691.1.13198 WP_004191691.1.13504 WP_004191691.1.13520 WP_004191691.1.13603 WP_004191691.1.13639 WP_004191691.1.14356 WP_004191691.1.14539 WP_004191691.1.14557 WP_004191691.1.1465 WP_004191691.1.15170 WP_004191691.1.15696 WP_004191691.1.16113 WP_004191691.1.16249 WP_004191691.1.16358 WP_004191691.1.16540 WP_004191691.1.16680 WP_004191691.1.16689 WP_004191691.1.17748 WP_004191691.1.17786 WP_004191691.1.18396 WP_004191691.1.18471 WP_004191691.1.18631 WP_004191691.1.18669 WP_004191691.1.18704 WP_004191691.1.19401 WP_004191691.1.19540 WP_004191691.1.19629 WP_004191691.1.19842 WP_004191691.1.20501 WP_004191691.1.20531 WP_004191691.1.20954 WP_004191691.1.21291 WP_004191691.1.21304 WP_004191691.1.21461 WP_004191691.1.21907 WP_004191691.1.22299 WP_004191691.1.22308 WP_004191691.1.22329 WP_004191691.1.23009 WP_004191691.1.23086 WP_004191691.1.23131 WP_004191691.1.23385 WP_004191691.1.23743 WP_004191691.1.23852 WP_004191691.1.23994 WP_004191691.1.24134 WP_004191691.1.24372 WP_004191691.1.25102 WP_004191691.1.25138 WP_004191691.1.25412 WP_004191691.1.25628 WP_004191691.1.25728 WP_004191691.1.259 WP_004191691.1.26054 WP_004191691.1.26445 WP_004191691.1.26633 WP_004191691.1.26838 WP_004191691.1.27146 WP_004191691.1.27363 WP_004191691.1.27390 WP_004191691.1.27420 WP_004191691.1.27441 WP_004191691.1.2767 WP_004191691.1.27909 WP_004191691.1.28066 WP_004191691.1.28187 WP_004191691.1.28619 WP_004191691.1.28632 WP_004191691.1.29148 WP_004191691.1.29178 WP_004191691.1.29335 WP_004191691.1.29520 WP_004191691.1.29853 WP_004191691.1.29948 WP_004191691.1.3041 WP_004191691.1.30671 WP_004191691.1.30729 WP_004191691.1.31343 WP_004191691.1.31831 WP_004191691.1.32174 WP_004191691.1.32221 WP_004191691.1.324 WP_004191691.1.32581 WP_004191691.1.32951 WP_004191691.1.33077 WP_004191691.1.33087 WP_004191691.1.33130 WP_004191691.1.33158 WP_004191691.1.33493 WP_004191691.1.34230 WP_004191691.1.34564 WP_004191691.1.34747 WP_004191691.1.35025 WP_004191691.1.35052 WP_004191691.1.35141 WP_004191691.1.35227 WP_004191691.1.35249 WP_004191691.1.35491 WP_004191691.1.35757 WP_004191691.1.35878 WP_004191691.1.36944 WP_004191691.1.37373 WP_004191691.1.37446 WP_004191691.1.37519 WP_004191691.1.37627 WP_004191691.1.37690 WP_004191691.1.37702 WP_004191691.1.37806 WP_004191691.1.37934 WP_004191691.1.3872 WP_004191691.1.38810 WP_004191691.1.38946 WP_004191691.1.39078 WP_004191691.1.39162 WP_004191691.1.39179 WP_004191691.1.3947 WP_004191691.1.39757 WP_004191691.1.40045 WP_004191691.1.40426 WP_004191691.1.42492 WP_004191691.1.42496 WP_004191691.1.42800 WP_004191691.1.43136 WP_004191691.1.43581 WP_004191691.1.43678 WP_004191691.1.43727 WP_004191691.1.43786 WP_004191691.1.43899 WP_004191691.1.44234 WP_004191691.1.45356 WP_004191691.1.45890 WP_004191691.1.46829 WP_004191691.1.47086 WP_004191691.1.47149 WP_004191691.1.4718 WP_004191691.1.48165 WP_004191691.1.48313 WP_004191691.1.49026 WP_004191691.1.50320 WP_004191691.1.50336 WP_004191691.1.50636 WP_004191691.1.50839 WP_004191691.1.51606 WP_004191691.1.52229 WP_004191691.1.52451 WP_004191691.1.52643 WP_004191691.1.52760 WP_004191691.1.52882 WP_004191691.1.5292 WP_004191691.1.53048 WP_004191691.1.53132 WP_004191691.1.53386 WP_004191691.1.53506 WP_004191691.1.53578 WP_004191691.1.53977 WP_004191691.1.54016 WP_004191691.1.5413 WP_004191691.1.54369 WP_004191691.1.54859 WP_004191691.1.54892 WP_004191691.1.55415 WP_004191691.1.55974 WP_004191691.1.55996 WP_004191691.1.5608 WP_004191691.1.56126 WP_004191691.1.56248 WP_004191691.1.56458 WP_004191691.1.56591 WP_004191691.1.56993 WP_004191691.1.57096 WP_004191691.1.5734 WP_004191691.1.57359 WP_004191691.1.57679 WP_004191691.1.58003 WP_004191691.1.58105 WP_004191691.1.58355 WP_004191691.1.58509 WP_004191691.1.58639 WP_004191691.1.58758 WP_004191691.1.5883 WP_004191691.1.59103 WP_004191691.1.59255 WP_004191691.1.59496 WP_004191691.1.59519 WP_004191691.1.59536 WP_004191691.1.60398 WP_004191691.1.61084 WP_004191691.1.61685 WP_004191691.1.61854 WP_004191691.1.61900 WP_004191691.1.62103 WP_004191691.1.62774 WP_004191691.1.63097 WP_004191691.1.63361 WP_004191691.1.63379 WP_004191691.1.63505 WP_004191691.1.63661 WP_004191691.1.63719 WP_004191691.1.64096 WP_004191691.1.64204 WP_004191691.1.64364 WP_004191691.1.64383 WP_004191691.1.64892 WP_004191691.1.65270 WP_004191691.1.65832 WP_004191691.1.67013 WP_004191691.1.67393 WP_004191691.1.67909 WP_004191691.1.67914 WP_004191691.1.67978 WP_004191691.1.68353 WP_004191691.1.68515 WP_004191691.1.68922 WP_004191691.1.69081 WP_004191691.1.69094 WP_004191691.1.69106 WP_004191691.1.69169 WP_004191691.1.69217 WP_004191691.1.69337 WP_004191691.1.69354 WP_004191691.1.69508 WP_004191691.1.69918 WP_004191691.1.70016 WP_004191691.1.70096 WP_004191691.1.70278 WP_004191691.1.70280 WP_004191691.1.70735 WP_004191691.1.71392 WP_004191691.1.72015 WP_004191691.1.72083 WP_004191691.1.72817 WP_004191691.1.73521 WP_004191691.1.73576 WP_004191691.1.73906 WP_004191691.1.73974 WP_004191691.1.7450 WP_004191691.1.75276 WP_004191691.1.75519 WP_004191691.1.75677 WP_004191691.1.75711 WP_004191691.1.75776 WP_004191691.1.75883 WP_004191691.1.76142 WP_004191691.1.76290 WP_004191691.1.76432 WP_004191691.1.76575 WP_004191691.1.766 WP_004191691.1.7703 WP_004191691.1.77689 WP_004191691.1.77845 WP_004191691.1.78029 WP_004191691.1.78278 WP_004191691.1.78506 WP_004191691.1.78557 WP_004191691.1.795 WP_004191691.1.79653 WP_004191691.1.79782 WP_004191691.1.80395 WP_004191691.1.80614 WP_004191691.1.81042 WP_004191691.1.8126 WP_004191691.1.81511 WP_004191691.1.81665 WP_004191691.1.82197 WP_004191691.1.82283 WP_004191691.1.82323 WP_004191691.1.82394 WP_004191691.1.82575 WP_004191691.1.8341 WP_004191691.1.83543 WP_004191691.1.83567 WP_004191691.1.83688 WP_004191691.1.8388 WP_004191691.1.8395 WP_004191691.1.84026 WP_004191691.1.84063 WP_004191691.1.84181 WP_004191691.1.84379 WP_004191691.1.84866 WP_004191691.1.85170 WP_004191691.1.85412 WP_004191691.1.85443 WP_004191691.1.85467 WP_004191691.1.85490 WP_004191691.1.85641 WP_004191691.1.8585 WP_004191691.1.86295 WP_004191691.1.86438 WP_004191691.1.86806 WP_004191691.1.86872 WP_004191691.1.8697 WP_004191691.1.87114 WP_004191691.1.87553 WP_004191691.1.87811 WP_004191691.1.88003 WP_004191691.1.88117 WP_004191691.1.88168 WP_004191691.1.88237 WP_004191691.1.88411 WP_004191691.1.91142 WP_004191691.1.91198 WP_004191691.1.91700 WP_004191691.1.91709 WP_004191691.1.91763 WP_004191691.1.92367 WP_004191691.1.92493 WP_004191691.1.92507 WP_004191691.1.9280 WP_004191691.1.9281 WP_004191691.1.92904 WP_004191691.1.93844 WP_004191691.1.94121 WP_004191691.1.94286 WP_004191691.1.95054 WP_004191691.1.9537 WP_004191691.1.95672 WP_004191691.1.95938 WP_004191691.1.95952 WP_004191691.1.96381 WP_004191691.1.96660 WP_004191691.1.97058 WP_004191691.1.98066 WP_004191691.1.98218 WP_004191691.1.98491 WP_004191691.1.98547 WP_004191691.1.98753 WP_004191691.1.98768 WP_004191691.1.98944 WP_004191691.1.99290 WP_004191691.1.9962 WP_004191691.1.9975 WP_004191691.1.9983 YP_103391.1.87047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]