SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126455050|ref|YP_001064323.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126455050|ref|YP_001064323.1|
Domain Number 1 Region: 33-278
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.76e-36
Family Phosphate binding protein-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126455050|ref|YP_001064323.1|
Sequence length 337
Comment hypothetical protein BURPS1106A_0038 [Burkholderia pseudomallei 1106a]
Sequence
MRTTLRALSLAAVAAGLSFGFAAQPAFADDGGKITIMVGGITKLIYLPARLTQELGYFKA
EGLDVELQSQPAGVDAENELLAGAVQGVVGFYDHTIDLQSKGKDVKAIAVLGQVPGEVEM
VSTKAAGAIKSMADVKGKTLGVTGLGSSTSFLTQYLAQQHGIAANQYTMLPVGADASFIA
AVKQGRIDAGMTTEPTVSVLEKNGDAKVLVDLRTLDGTRAALGGTYPAASLYVQSAWADT
HKAQAAKLAHAFARTMQFIHTHSAEEIAAKMPADYQKDKALYVSALKASLPMYTPDGRMP
ADGPATVLKVLSAFNPSVKGKHIDLSKTYTNDFVSAK
Download sequence
Identical sequences A0A069B3D1 A0A0E1S877 A0A0E1TSX2 A0A0E1UX52 A0A0E1W7V0 A0A0F6GD37 A0A0F6L7M7 A0A0H3HDP3 A0A153KI94 A0A2K3FDC2 A0A2K3GAS5 A0A2K3HK60 A0A2K3IAD3 A2S7B3 A3N422 A3NPQ2 A8EGJ1 B1HAM6 C4KYH8 Q3JXN6 Q63Z04
gi|403516706|ref|YP_006650839.1| gi|126449466|ref|YP_001082220.1| gi|526472409|ref|YP_008342061.1| gi|556576693|ref|YP_008743990.1| gi|237814431|ref|YP_002898882.1| gi|386860164|ref|YP_006273113.1| gi|76808747|ref|YP_331667.1| WP_004202867.1.100104 WP_004202867.1.100195 WP_004202867.1.10047 WP_004202867.1.100583 WP_004202867.1.100720 WP_004202867.1.100727 WP_004202867.1.100825 WP_004202867.1.100900 WP_004202867.1.1010 WP_004202867.1.101060 WP_004202867.1.101307 WP_004202867.1.101381 WP_004202867.1.101559 WP_004202867.1.101588 WP_004202867.1.101783 WP_004202867.1.102051 WP_004202867.1.10269 WP_004202867.1.10290 WP_004202867.1.10359 WP_004202867.1.10553 WP_004202867.1.10633 WP_004202867.1.10746 WP_004202867.1.10907 WP_004202867.1.1098 WP_004202867.1.11046 WP_004202867.1.11072 WP_004202867.1.11160 WP_004202867.1.11268 WP_004202867.1.11404 WP_004202867.1.11825 WP_004202867.1.11893 WP_004202867.1.11996 WP_004202867.1.11998 WP_004202867.1.1266 WP_004202867.1.12731 WP_004202867.1.12793 WP_004202867.1.12856 WP_004202867.1.12860 WP_004202867.1.13198 WP_004202867.1.13309 WP_004202867.1.13504 WP_004202867.1.13520 WP_004202867.1.13597 WP_004202867.1.13603 WP_004202867.1.13639 WP_004202867.1.13925 WP_004202867.1.13950 WP_004202867.1.14356 WP_004202867.1.14539 WP_004202867.1.14557 WP_004202867.1.1465 WP_004202867.1.14660 WP_004202867.1.15170 WP_004202867.1.15364 WP_004202867.1.15525 WP_004202867.1.15673 WP_004202867.1.15696 WP_004202867.1.16090 WP_004202867.1.16113 WP_004202867.1.16249 WP_004202867.1.16358 WP_004202867.1.16540 WP_004202867.1.16561 WP_004202867.1.16625 WP_004202867.1.16680 WP_004202867.1.16689 WP_004202867.1.16749 WP_004202867.1.17067 WP_004202867.1.17068 WP_004202867.1.17278 WP_004202867.1.17473 WP_004202867.1.17748 WP_004202867.1.17786 WP_004202867.1.18058 WP_004202867.1.18396 WP_004202867.1.18405 WP_004202867.1.18471 WP_004202867.1.18631 WP_004202867.1.18669 WP_004202867.1.18704 WP_004202867.1.18744 WP_004202867.1.18868 WP_004202867.1.18906 WP_004202867.1.19401 WP_004202867.1.19486 WP_004202867.1.19540 WP_004202867.1.19629 WP_004202867.1.1976 WP_004202867.1.19815 WP_004202867.1.19842 WP_004202867.1.19854 WP_004202867.1.20021 WP_004202867.1.20246 WP_004202867.1.20501 WP_004202867.1.20520 WP_004202867.1.20673 WP_004202867.1.20954 WP_004202867.1.21147 WP_004202867.1.21205 WP_004202867.1.21291 WP_004202867.1.21304 WP_004202867.1.21409 WP_004202867.1.21442 WP_004202867.1.21461 WP_004202867.1.21653 WP_004202867.1.21809 WP_004202867.1.21907 WP_004202867.1.22046 WP_004202867.1.22299 WP_004202867.1.22308 WP_004202867.1.2261 WP_004202867.1.22625 WP_004202867.1.22779 WP_004202867.1.23009 WP_004202867.1.23086 WP_004202867.1.23104 WP_004202867.1.23131 WP_004202867.1.2317 WP_004202867.1.23743 WP_004202867.1.23852 WP_004202867.1.23994 WP_004202867.1.24020 WP_004202867.1.2404 WP_004202867.1.24134 WP_004202867.1.24314 WP_004202867.1.24372 WP_004202867.1.24454 WP_004202867.1.24513 WP_004202867.1.2462 WP_004202867.1.24701 WP_004202867.1.25068 WP_004202867.1.25102 WP_004202867.1.25138 WP_004202867.1.25265 WP_004202867.1.25412 WP_004202867.1.25628 WP_004202867.1.25728 WP_004202867.1.259 WP_004202867.1.26054 WP_004202867.1.26502 WP_004202867.1.26535 WP_004202867.1.26565 WP_004202867.1.26633 WP_004202867.1.26645 WP_004202867.1.267 WP_004202867.1.26838 WP_004202867.1.26849 WP_004202867.1.27064 WP_004202867.1.27069 WP_004202867.1.27146 WP_004202867.1.27363 WP_004202867.1.27390 WP_004202867.1.27399 WP_004202867.1.27420 WP_004202867.1.27441 WP_004202867.1.27597 WP_004202867.1.2767 WP_004202867.1.27810 WP_004202867.1.27909 WP_004202867.1.28018 WP_004202867.1.28066 WP_004202867.1.28187 WP_004202867.1.28453 WP_004202867.1.28594 WP_004202867.1.28619 WP_004202867.1.28632 WP_004202867.1.29161 WP_004202867.1.29178 WP_004202867.1.29335 WP_004202867.1.29405 WP_004202867.1.29508 WP_004202867.1.29520 WP_004202867.1.29547 WP_004202867.1.29658 WP_004202867.1.29853 WP_004202867.1.29878 WP_004202867.1.29887 WP_004202867.1.29899 WP_004202867.1.29948 WP_004202867.1.30311 WP_004202867.1.30382 WP_004202867.1.3041 WP_004202867.1.30671 WP_004202867.1.3069 WP_004202867.1.30729 WP_004202867.1.30937 WP_004202867.1.30966 WP_004202867.1.31343 WP_004202867.1.31723 WP_004202867.1.32174 WP_004202867.1.32182 WP_004202867.1.32221 WP_004202867.1.324 WP_004202867.1.3251 WP_004202867.1.3273 WP_004202867.1.32951 WP_004202867.1.33077 WP_004202867.1.33087 WP_004202867.1.33130 WP_004202867.1.33157 WP_004202867.1.33158 WP_004202867.1.33165 WP_004202867.1.332 WP_004202867.1.33366 WP_004202867.1.33419 WP_004202867.1.33493 WP_004202867.1.33543 WP_004202867.1.33573 WP_004202867.1.33779 WP_004202867.1.34230 WP_004202867.1.34333 WP_004202867.1.34393 WP_004202867.1.34564 WP_004202867.1.35025 WP_004202867.1.35052 WP_004202867.1.35090 WP_004202867.1.35141 WP_004202867.1.35227 WP_004202867.1.35249 WP_004202867.1.35474 WP_004202867.1.35485 WP_004202867.1.35491 WP_004202867.1.35825 WP_004202867.1.36106 WP_004202867.1.36174 WP_004202867.1.36259 WP_004202867.1.36527 WP_004202867.1.366 WP_004202867.1.36662 WP_004202867.1.36666 WP_004202867.1.36944 WP_004202867.1.3706 WP_004202867.1.37373 WP_004202867.1.37428 WP_004202867.1.37446 WP_004202867.1.37517 WP_004202867.1.37519 WP_004202867.1.37535 WP_004202867.1.37581 WP_004202867.1.37622 WP_004202867.1.37627 WP_004202867.1.37690 WP_004202867.1.37702 WP_004202867.1.37725 WP_004202867.1.37806 WP_004202867.1.37934 WP_004202867.1.37959 WP_004202867.1.37994 WP_004202867.1.38115 WP_004202867.1.38442 WP_004202867.1.38490 WP_004202867.1.38683 WP_004202867.1.3872 WP_004202867.1.38810 WP_004202867.1.39078 WP_004202867.1.39162 WP_004202867.1.39179 WP_004202867.1.39349 WP_004202867.1.3947 WP_004202867.1.39595 WP_004202867.1.39757 WP_004202867.1.39898 WP_004202867.1.40021 WP_004202867.1.40045 WP_004202867.1.40191 WP_004202867.1.40235 WP_004202867.1.40275 WP_004202867.1.40388 WP_004202867.1.40390 WP_004202867.1.40426 WP_004202867.1.40448 WP_004202867.1.4077 WP_004202867.1.41477 WP_004202867.1.41588 WP_004202867.1.41945 WP_004202867.1.42408 WP_004202867.1.42492 WP_004202867.1.42496 WP_004202867.1.42800 WP_004202867.1.43136 WP_004202867.1.43156 WP_004202867.1.43373 WP_004202867.1.43542 WP_004202867.1.43581 WP_004202867.1.43587 WP_004202867.1.43678 WP_004202867.1.43727 WP_004202867.1.43786 WP_004202867.1.44179 WP_004202867.1.44234 WP_004202867.1.44352 WP_004202867.1.44414 WP_004202867.1.44540 WP_004202867.1.44824 WP_004202867.1.45284 WP_004202867.1.45348 WP_004202867.1.45356 WP_004202867.1.45537 WP_004202867.1.45715 WP_004202867.1.45890 WP_004202867.1.4631 WP_004202867.1.46575 WP_004202867.1.46757 WP_004202867.1.46829 WP_004202867.1.4693 WP_004202867.1.46969 WP_004202867.1.47086 WP_004202867.1.47149 WP_004202867.1.4718 WP_004202867.1.47564 WP_004202867.1.48093 WP_004202867.1.4810 WP_004202867.1.48165 WP_004202867.1.48407 WP_004202867.1.48464 WP_004202867.1.49026 WP_004202867.1.49717 WP_004202867.1.49872 WP_004202867.1.50174 WP_004202867.1.50320 WP_004202867.1.50336 WP_004202867.1.50401 WP_004202867.1.50636 WP_004202867.1.50788 WP_004202867.1.50839 WP_004202867.1.5105 WP_004202867.1.51606 WP_004202867.1.51666 WP_004202867.1.5173 WP_004202867.1.5182 WP_004202867.1.51874 WP_004202867.1.51891 WP_004202867.1.51902 WP_004202867.1.52229 WP_004202867.1.52365 WP_004202867.1.52407 WP_004202867.1.52451 WP_004202867.1.52521 WP_004202867.1.52547 WP_004202867.1.52643 WP_004202867.1.52655 WP_004202867.1.52731 WP_004202867.1.52760 WP_004202867.1.52882 WP_004202867.1.5292 WP_004202867.1.53034 WP_004202867.1.53048 WP_004202867.1.53103 WP_004202867.1.53132 WP_004202867.1.53282 WP_004202867.1.5338 WP_004202867.1.53386 WP_004202867.1.53506 WP_004202867.1.53578 WP_004202867.1.54016 WP_004202867.1.5413 WP_004202867.1.54312 WP_004202867.1.54369 WP_004202867.1.54804 WP_004202867.1.54859 WP_004202867.1.55038 WP_004202867.1.55415 WP_004202867.1.55691 WP_004202867.1.55755 WP_004202867.1.55974 WP_004202867.1.55996 WP_004202867.1.5608 WP_004202867.1.56248 WP_004202867.1.5641 WP_004202867.1.56451 WP_004202867.1.56458 WP_004202867.1.56591 WP_004202867.1.56744 WP_004202867.1.56949 WP_004202867.1.56993 WP_004202867.1.57046 WP_004202867.1.57096 WP_004202867.1.57247 WP_004202867.1.5734 WP_004202867.1.57341 WP_004202867.1.57359 WP_004202867.1.5776 WP_004202867.1.58003 WP_004202867.1.58105 WP_004202867.1.58190 WP_004202867.1.58355 WP_004202867.1.58362 WP_004202867.1.58390 WP_004202867.1.58405 WP_004202867.1.58509 WP_004202867.1.58523 WP_004202867.1.58578 WP_004202867.1.58758 WP_004202867.1.5883 WP_004202867.1.59103 WP_004202867.1.59200 WP_004202867.1.59255 WP_004202867.1.59422 WP_004202867.1.59496 WP_004202867.1.59519 WP_004202867.1.59536 WP_004202867.1.59549 WP_004202867.1.59747 WP_004202867.1.60398 WP_004202867.1.60769 WP_004202867.1.60810 WP_004202867.1.60833 WP_004202867.1.60836 WP_004202867.1.60969 WP_004202867.1.61073 WP_004202867.1.61084 WP_004202867.1.61202 WP_004202867.1.61455 WP_004202867.1.61588 WP_004202867.1.61685 WP_004202867.1.61723 WP_004202867.1.6186 WP_004202867.1.61900 WP_004202867.1.62103 WP_004202867.1.62183 WP_004202867.1.62774 WP_004202867.1.63097 WP_004202867.1.63261 WP_004202867.1.63361 WP_004202867.1.63379 WP_004202867.1.63439 WP_004202867.1.63505 WP_004202867.1.63661 WP_004202867.1.63719 WP_004202867.1.63942 WP_004202867.1.64068 WP_004202867.1.64096 WP_004202867.1.64166 WP_004202867.1.64204 WP_004202867.1.64364 WP_004202867.1.64683 WP_004202867.1.64892 WP_004202867.1.65093 WP_004202867.1.65270 WP_004202867.1.65468 WP_004202867.1.65832 WP_004202867.1.65994 WP_004202867.1.66257 WP_004202867.1.66321 WP_004202867.1.66380 WP_004202867.1.66465 WP_004202867.1.66594 WP_004202867.1.67013 WP_004202867.1.67117 WP_004202867.1.67182 WP_004202867.1.67229 WP_004202867.1.67559 WP_004202867.1.6765 WP_004202867.1.67860 WP_004202867.1.67909 WP_004202867.1.67914 WP_004202867.1.67978 WP_004202867.1.6835 WP_004202867.1.68353 WP_004202867.1.68515 WP_004202867.1.68664 WP_004202867.1.68886 WP_004202867.1.68922 WP_004202867.1.69022 WP_004202867.1.69081 WP_004202867.1.69094 WP_004202867.1.69106 WP_004202867.1.69169 WP_004202867.1.69217 WP_004202867.1.69337 WP_004202867.1.69354 WP_004202867.1.69770 WP_004202867.1.69918 WP_004202867.1.70016 WP_004202867.1.7006 WP_004202867.1.70066 WP_004202867.1.70096 WP_004202867.1.70278 WP_004202867.1.70280 WP_004202867.1.70735 WP_004202867.1.71392 WP_004202867.1.71444 WP_004202867.1.71564 WP_004202867.1.71901 WP_004202867.1.72015 WP_004202867.1.72083 WP_004202867.1.72545 WP_004202867.1.72798 WP_004202867.1.72817 WP_004202867.1.73317 WP_004202867.1.73418 WP_004202867.1.73521 WP_004202867.1.73576 WP_004202867.1.73906 WP_004202867.1.73974 WP_004202867.1.74177 WP_004202867.1.74425 WP_004202867.1.7450 WP_004202867.1.74569 WP_004202867.1.74675 WP_004202867.1.74690 WP_004202867.1.75001 WP_004202867.1.75027 WP_004202867.1.75075 WP_004202867.1.75230 WP_004202867.1.75276 WP_004202867.1.75519 WP_004202867.1.75677 WP_004202867.1.75708 WP_004202867.1.75711 WP_004202867.1.75776 WP_004202867.1.75861 WP_004202867.1.75883 WP_004202867.1.75913 WP_004202867.1.75937 WP_004202867.1.76142 WP_004202867.1.76290 WP_004202867.1.76432 WP_004202867.1.76522 WP_004202867.1.76575 WP_004202867.1.766 WP_004202867.1.7703 WP_004202867.1.77249 WP_004202867.1.77287 WP_004202867.1.77319 WP_004202867.1.77689 WP_004202867.1.77788 WP_004202867.1.77845 WP_004202867.1.78029 WP_004202867.1.78278 WP_004202867.1.78506 WP_004202867.1.78557 WP_004202867.1.78628 WP_004202867.1.78759 WP_004202867.1.78807 WP_004202867.1.78827 WP_004202867.1.79052 WP_004202867.1.79360 WP_004202867.1.795 WP_004202867.1.79689 WP_004202867.1.79710 WP_004202867.1.79725 WP_004202867.1.79782 WP_004202867.1.80098 WP_004202867.1.80302 WP_004202867.1.80395 WP_004202867.1.80433 WP_004202867.1.80614 WP_004202867.1.80923 WP_004202867.1.81042 WP_004202867.1.8126 WP_004202867.1.81479 WP_004202867.1.81511 WP_004202867.1.81543 WP_004202867.1.81665 WP_004202867.1.82197 WP_004202867.1.82323 WP_004202867.1.82394 WP_004202867.1.82506 WP_004202867.1.82575 WP_004202867.1.82694 WP_004202867.1.82727 WP_004202867.1.82915 WP_004202867.1.82950 WP_004202867.1.83080 WP_004202867.1.83357 WP_004202867.1.8341 WP_004202867.1.83487 WP_004202867.1.83543 WP_004202867.1.83567 WP_004202867.1.83609 WP_004202867.1.83688 WP_004202867.1.8388 WP_004202867.1.8390 WP_004202867.1.8395 WP_004202867.1.83967 WP_004202867.1.84002 WP_004202867.1.84026 WP_004202867.1.84063 WP_004202867.1.84181 WP_004202867.1.84375 WP_004202867.1.84379 WP_004202867.1.84480 WP_004202867.1.84654 WP_004202867.1.84866 WP_004202867.1.85170 WP_004202867.1.85412 WP_004202867.1.85443 WP_004202867.1.85467 WP_004202867.1.85490 WP_004202867.1.85565 WP_004202867.1.85584 WP_004202867.1.856 WP_004202867.1.85641 WP_004202867.1.85645 WP_004202867.1.85774 WP_004202867.1.8585 WP_004202867.1.8629 WP_004202867.1.86295 WP_004202867.1.86438 WP_004202867.1.86525 WP_004202867.1.86806 WP_004202867.1.86872 WP_004202867.1.8697 WP_004202867.1.87114 WP_004202867.1.87278 WP_004202867.1.87324 WP_004202867.1.87553 WP_004202867.1.87652 WP_004202867.1.87759 WP_004202867.1.87811 WP_004202867.1.88003 WP_004202867.1.88117 WP_004202867.1.88168 WP_004202867.1.88237 WP_004202867.1.88322 WP_004202867.1.88369 WP_004202867.1.88411 WP_004202867.1.88666 WP_004202867.1.88682 WP_004202867.1.88764 WP_004202867.1.88920 WP_004202867.1.89093 WP_004202867.1.8912 WP_004202867.1.89240 WP_004202867.1.89435 WP_004202867.1.89514 WP_004202867.1.89782 WP_004202867.1.90079 WP_004202867.1.90471 WP_004202867.1.9079 WP_004202867.1.91025 WP_004202867.1.91142 WP_004202867.1.91198 WP_004202867.1.91700 WP_004202867.1.91709 WP_004202867.1.91763 WP_004202867.1.91823 WP_004202867.1.92095 WP_004202867.1.9236 WP_004202867.1.92367 WP_004202867.1.92406 WP_004202867.1.92430 WP_004202867.1.92493 WP_004202867.1.92507 WP_004202867.1.9280 WP_004202867.1.9281 WP_004202867.1.92904 WP_004202867.1.93844 WP_004202867.1.93845 WP_004202867.1.94023 WP_004202867.1.94050 WP_004202867.1.94117 WP_004202867.1.94121 WP_004202867.1.94286 WP_004202867.1.94403 WP_004202867.1.94498 WP_004202867.1.94520 WP_004202867.1.9479 WP_004202867.1.94901 WP_004202867.1.94926 WP_004202867.1.95054 WP_004202867.1.95300 WP_004202867.1.95339 WP_004202867.1.9537 WP_004202867.1.95420 WP_004202867.1.95587 WP_004202867.1.95644 WP_004202867.1.95672 WP_004202867.1.95938 WP_004202867.1.96381 WP_004202867.1.97058 WP_004202867.1.97112 WP_004202867.1.97148 WP_004202867.1.97989 WP_004202867.1.98066 WP_004202867.1.98218 WP_004202867.1.98316 WP_004202867.1.98491 WP_004202867.1.98547 WP_004202867.1.98688 WP_004202867.1.98713 WP_004202867.1.98753 WP_004202867.1.98768 WP_004202867.1.98944 WP_004202867.1.99061 WP_004202867.1.99069 WP_004202867.1.99160 WP_004202867.1.99233 WP_004202867.1.99290 WP_004202867.1.9962 WP_004202867.1.99629 WP_004202867.1.99741 WP_004202867.1.9975 WP_004202867.1.9983 WP_004202867.1.99890 YP_106661.1.59693 gi|126440487|ref|YP_001057093.1| 272560.BPSL0036 320372.BURPS1710b_0251 320373.BURPS668_0038 320389.BMA10247_2697 357348.BURPS1106A_0038 412022.BMA10229_A1855 536230.GBP346_A4229 gi|126455050|ref|YP_001064323.1| gi|53717675|ref|YP_106661.1| gi|124383958|ref|YP_001027832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]