SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126455413|ref|YP_001066091.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126455413|ref|YP_001066091.1|
Domain Number 1 Region: 8-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-71
Family Phosphate binding protein-like 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126455413|ref|YP_001066091.1|
Sequence length 264
Comment amino acid ABC transporter substrate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MKIASLKKLLVTGLIGASFAAATAHAADLLDEVKQRGTLRIGLEGTFPPFNSKNPQGELV
GFDVDIAKAIAAKLGVKPEFVTTEWSGIIAGLQAGKFDVIVNQVGITDPRKQTLDFSPAY
TFSSAQLIQRKDDARQFKSLEDLKGKKLGVALGTNYMDMAKSVPGIDVKTYPGAPEYLRD
LAAGRLDAALNDRLMLAYLTKNAQLPLRPGANVGSANPSGIPFKKGNPKFAKAIADAMTQ
LEADGTFTKISDKWFGIDVTKPVK
Download sequence
Identical sequences A0A069B0P6 A0A0E1S5Y0 A0A0E1TSB3 A0A0E1UMR7 A0A0F6GCB9 A0A0F6LCY7 A0A0H2WEK1 A0A0H3HNG7 A0A290YE64 A0A2K3FI19 A0A2K3GIL5 A0A2K3HP74 A0A2K3IET2 A2S375 A3N924 A3NUS0 B1HIM6 C4B0C3 C4KX66 Q63TV0
gi|126455413|ref|YP_001066091.1| gi|386861899|ref|YP_006274848.1| gi|126450875|ref|YP_001080333.1| gi|53723464|ref|YP_102925.1| gi|121601368|ref|YP_993059.1| gi|53719480|ref|YP_108466.1| 243160.BMA1254 272560.BPSL1867 320373.BURPS668_1808 320388.BMASAVP1_A1737 320389.BMA10247_0767 357348.BURPS1106A_1824 412022.BMA10229_A0395 536230.GBP346_A1847 WP_004191674.1.100104 WP_004191674.1.100195 WP_004191674.1.10047 WP_004191674.1.100583 WP_004191674.1.100720 WP_004191674.1.100727 WP_004191674.1.100825 WP_004191674.1.100900 WP_004191674.1.1010 WP_004191674.1.101060 WP_004191674.1.101307 WP_004191674.1.101381 WP_004191674.1.101559 WP_004191674.1.101588 WP_004191674.1.101783 WP_004191674.1.102051 WP_004191674.1.10269 WP_004191674.1.10290 WP_004191674.1.10359 WP_004191674.1.10553 WP_004191674.1.10633 WP_004191674.1.10746 WP_004191674.1.10907 WP_004191674.1.1098 WP_004191674.1.11046 WP_004191674.1.11072 WP_004191674.1.11160 WP_004191674.1.11268 WP_004191674.1.11404 WP_004191674.1.11747 WP_004191674.1.11825 WP_004191674.1.11893 WP_004191674.1.11996 WP_004191674.1.11998 WP_004191674.1.1266 WP_004191674.1.12731 WP_004191674.1.12793 WP_004191674.1.12856 WP_004191674.1.12860 WP_004191674.1.13198 WP_004191674.1.13309 WP_004191674.1.13504 WP_004191674.1.13520 WP_004191674.1.13597 WP_004191674.1.13639 WP_004191674.1.13925 WP_004191674.1.13950 WP_004191674.1.14356 WP_004191674.1.14539 WP_004191674.1.14557 WP_004191674.1.14660 WP_004191674.1.15170 WP_004191674.1.15364 WP_004191674.1.15525 WP_004191674.1.15673 WP_004191674.1.15696 WP_004191674.1.16090 WP_004191674.1.16113 WP_004191674.1.16249 WP_004191674.1.16358 WP_004191674.1.16561 WP_004191674.1.16625 WP_004191674.1.16680 WP_004191674.1.16689 WP_004191674.1.16749 WP_004191674.1.17067 WP_004191674.1.17068 WP_004191674.1.17278 WP_004191674.1.17473 WP_004191674.1.17748 WP_004191674.1.17786 WP_004191674.1.18058 WP_004191674.1.18396 WP_004191674.1.18405 WP_004191674.1.18471 WP_004191674.1.18549 WP_004191674.1.18631 WP_004191674.1.18669 WP_004191674.1.18744 WP_004191674.1.18868 WP_004191674.1.18906 WP_004191674.1.19401 WP_004191674.1.19486 WP_004191674.1.19540 WP_004191674.1.19629 WP_004191674.1.1976 WP_004191674.1.19815 WP_004191674.1.19842 WP_004191674.1.19854 WP_004191674.1.20021 WP_004191674.1.20246 WP_004191674.1.20501 WP_004191674.1.20520 WP_004191674.1.20531 WP_004191674.1.20673 WP_004191674.1.20954 WP_004191674.1.21147 WP_004191674.1.21205 WP_004191674.1.21291 WP_004191674.1.21304 WP_004191674.1.21409 WP_004191674.1.21442 WP_004191674.1.21461 WP_004191674.1.21653 WP_004191674.1.21809 WP_004191674.1.21907 WP_004191674.1.22046 WP_004191674.1.22299 WP_004191674.1.22308 WP_004191674.1.22329 WP_004191674.1.2261 WP_004191674.1.22625 WP_004191674.1.22779 WP_004191674.1.23009 WP_004191674.1.23086 WP_004191674.1.23104 WP_004191674.1.23131 WP_004191674.1.2317 WP_004191674.1.23385 WP_004191674.1.23743 WP_004191674.1.23852 WP_004191674.1.23994 WP_004191674.1.24020 WP_004191674.1.2404 WP_004191674.1.24134 WP_004191674.1.24314 WP_004191674.1.24372 WP_004191674.1.24454 WP_004191674.1.24513 WP_004191674.1.2462 WP_004191674.1.24701 WP_004191674.1.25068 WP_004191674.1.25102 WP_004191674.1.25138 WP_004191674.1.25265 WP_004191674.1.25412 WP_004191674.1.25628 WP_004191674.1.25728 WP_004191674.1.259 WP_004191674.1.26054 WP_004191674.1.26445 WP_004191674.1.26502 WP_004191674.1.26535 WP_004191674.1.26565 WP_004191674.1.26633 WP_004191674.1.26645 WP_004191674.1.267 WP_004191674.1.26838 WP_004191674.1.26849 WP_004191674.1.27064 WP_004191674.1.27069 WP_004191674.1.27146 WP_004191674.1.27363 WP_004191674.1.27390 WP_004191674.1.27399 WP_004191674.1.27420 WP_004191674.1.27441 WP_004191674.1.27597 WP_004191674.1.2767 WP_004191674.1.27810 WP_004191674.1.27909 WP_004191674.1.28018 WP_004191674.1.28066 WP_004191674.1.28187 WP_004191674.1.28453 WP_004191674.1.28594 WP_004191674.1.28619 WP_004191674.1.28632 WP_004191674.1.29148 WP_004191674.1.29161 WP_004191674.1.29335 WP_004191674.1.29405 WP_004191674.1.29508 WP_004191674.1.29520 WP_004191674.1.29547 WP_004191674.1.29658 WP_004191674.1.29853 WP_004191674.1.29878 WP_004191674.1.29887 WP_004191674.1.29899 WP_004191674.1.29948 WP_004191674.1.30311 WP_004191674.1.30382 WP_004191674.1.3041 WP_004191674.1.30671 WP_004191674.1.3069 WP_004191674.1.30729 WP_004191674.1.30937 WP_004191674.1.30966 WP_004191674.1.31343 WP_004191674.1.31723 WP_004191674.1.32174 WP_004191674.1.32182 WP_004191674.1.32221 WP_004191674.1.324 WP_004191674.1.3251 WP_004191674.1.32581 WP_004191674.1.3273 WP_004191674.1.32951 WP_004191674.1.33077 WP_004191674.1.33087 WP_004191674.1.33130 WP_004191674.1.33157 WP_004191674.1.33158 WP_004191674.1.33165 WP_004191674.1.332 WP_004191674.1.33366 WP_004191674.1.33419 WP_004191674.1.33493 WP_004191674.1.33543 WP_004191674.1.33573 WP_004191674.1.33779 WP_004191674.1.34230 WP_004191674.1.34333 WP_004191674.1.34393 WP_004191674.1.34564 WP_004191674.1.34747 WP_004191674.1.35025 WP_004191674.1.35052 WP_004191674.1.35090 WP_004191674.1.35141 WP_004191674.1.35227 WP_004191674.1.35249 WP_004191674.1.35474 WP_004191674.1.35485 WP_004191674.1.35491 WP_004191674.1.35757 WP_004191674.1.35825 WP_004191674.1.35878 WP_004191674.1.36106 WP_004191674.1.36174 WP_004191674.1.36259 WP_004191674.1.36527 WP_004191674.1.366 WP_004191674.1.36662 WP_004191674.1.36666 WP_004191674.1.36944 WP_004191674.1.37 WP_004191674.1.3706 WP_004191674.1.37373 WP_004191674.1.37428 WP_004191674.1.37446 WP_004191674.1.37517 WP_004191674.1.37519 WP_004191674.1.37535 WP_004191674.1.37581 WP_004191674.1.37622 WP_004191674.1.37627 WP_004191674.1.37690 WP_004191674.1.37702 WP_004191674.1.37725 WP_004191674.1.37806 WP_004191674.1.37934 WP_004191674.1.37959 WP_004191674.1.37994 WP_004191674.1.38115 WP_004191674.1.38442 WP_004191674.1.38490 WP_004191674.1.38683 WP_004191674.1.3872 WP_004191674.1.38810 WP_004191674.1.38946 WP_004191674.1.39078 WP_004191674.1.39162 WP_004191674.1.39179 WP_004191674.1.39349 WP_004191674.1.3947 WP_004191674.1.39595 WP_004191674.1.39757 WP_004191674.1.39898 WP_004191674.1.40021 WP_004191674.1.40045 WP_004191674.1.40191 WP_004191674.1.40235 WP_004191674.1.40275 WP_004191674.1.40388 WP_004191674.1.40390 WP_004191674.1.40426 WP_004191674.1.40448 WP_004191674.1.4077 WP_004191674.1.41477 WP_004191674.1.41945 WP_004191674.1.42408 WP_004191674.1.42492 WP_004191674.1.42496 WP_004191674.1.42800 WP_004191674.1.43136 WP_004191674.1.43156 WP_004191674.1.43373 WP_004191674.1.43542 WP_004191674.1.43581 WP_004191674.1.43587 WP_004191674.1.43678 WP_004191674.1.43727 WP_004191674.1.43786 WP_004191674.1.43899 WP_004191674.1.44179 WP_004191674.1.44234 WP_004191674.1.44352 WP_004191674.1.44414 WP_004191674.1.44540 WP_004191674.1.44824 WP_004191674.1.45284 WP_004191674.1.45348 WP_004191674.1.45356 WP_004191674.1.45537 WP_004191674.1.45715 WP_004191674.1.45890 WP_004191674.1.4631 WP_004191674.1.46575 WP_004191674.1.46757 WP_004191674.1.46829 WP_004191674.1.4693 WP_004191674.1.46969 WP_004191674.1.47086 WP_004191674.1.47149 WP_004191674.1.4718 WP_004191674.1.47564 WP_004191674.1.48093 WP_004191674.1.4810 WP_004191674.1.48165 WP_004191674.1.48313 WP_004191674.1.48407 WP_004191674.1.48464 WP_004191674.1.49026 WP_004191674.1.49717 WP_004191674.1.49872 WP_004191674.1.50174 WP_004191674.1.50320 WP_004191674.1.50336 WP_004191674.1.50636 WP_004191674.1.50788 WP_004191674.1.50839 WP_004191674.1.5105 WP_004191674.1.51606 WP_004191674.1.51666 WP_004191674.1.5173 WP_004191674.1.5182 WP_004191674.1.51874 WP_004191674.1.51891 WP_004191674.1.51902 WP_004191674.1.52229 WP_004191674.1.52365 WP_004191674.1.52407 WP_004191674.1.52451 WP_004191674.1.52521 WP_004191674.1.52547 WP_004191674.1.52643 WP_004191674.1.52655 WP_004191674.1.52731 WP_004191674.1.52760 WP_004191674.1.52882 WP_004191674.1.5292 WP_004191674.1.53034 WP_004191674.1.53048 WP_004191674.1.53103 WP_004191674.1.53132 WP_004191674.1.53282 WP_004191674.1.5338 WP_004191674.1.53386 WP_004191674.1.53506 WP_004191674.1.53578 WP_004191674.1.53977 WP_004191674.1.54016 WP_004191674.1.5413 WP_004191674.1.54312 WP_004191674.1.54369 WP_004191674.1.54804 WP_004191674.1.54859 WP_004191674.1.54892 WP_004191674.1.55038 WP_004191674.1.55415 WP_004191674.1.55691 WP_004191674.1.55755 WP_004191674.1.55974 WP_004191674.1.55996 WP_004191674.1.5608 WP_004191674.1.56126 WP_004191674.1.56248 WP_004191674.1.5641 WP_004191674.1.56451 WP_004191674.1.56458 WP_004191674.1.56591 WP_004191674.1.56744 WP_004191674.1.56949 WP_004191674.1.56993 WP_004191674.1.57046 WP_004191674.1.57096 WP_004191674.1.57247 WP_004191674.1.5734 WP_004191674.1.57341 WP_004191674.1.57359 WP_004191674.1.57679 WP_004191674.1.5776 WP_004191674.1.58003 WP_004191674.1.58105 WP_004191674.1.58190 WP_004191674.1.58355 WP_004191674.1.58362 WP_004191674.1.58390 WP_004191674.1.58405 WP_004191674.1.58509 WP_004191674.1.58523 WP_004191674.1.58578 WP_004191674.1.58639 WP_004191674.1.58758 WP_004191674.1.5883 WP_004191674.1.59103 WP_004191674.1.59200 WP_004191674.1.59255 WP_004191674.1.59422 WP_004191674.1.59496 WP_004191674.1.59519 WP_004191674.1.59536 WP_004191674.1.59549 WP_004191674.1.59747 WP_004191674.1.60398 WP_004191674.1.60769 WP_004191674.1.60810 WP_004191674.1.60833 WP_004191674.1.60836 WP_004191674.1.60969 WP_004191674.1.61073 WP_004191674.1.61084 WP_004191674.1.61202 WP_004191674.1.61455 WP_004191674.1.61588 WP_004191674.1.61685 WP_004191674.1.61723 WP_004191674.1.61854 WP_004191674.1.6186 WP_004191674.1.61900 WP_004191674.1.62103 WP_004191674.1.62183 WP_004191674.1.62774 WP_004191674.1.63097 WP_004191674.1.63261 WP_004191674.1.63361 WP_004191674.1.63379 WP_004191674.1.63439 WP_004191674.1.63505 WP_004191674.1.63661 WP_004191674.1.63719 WP_004191674.1.63942 WP_004191674.1.64068 WP_004191674.1.64096 WP_004191674.1.64166 WP_004191674.1.64204 WP_004191674.1.64364 WP_004191674.1.64383 WP_004191674.1.64542 WP_004191674.1.64683 WP_004191674.1.64892 WP_004191674.1.65093 WP_004191674.1.65270 WP_004191674.1.65468 WP_004191674.1.65832 WP_004191674.1.65994 WP_004191674.1.66257 WP_004191674.1.66321 WP_004191674.1.66380 WP_004191674.1.66465 WP_004191674.1.66594 WP_004191674.1.67013 WP_004191674.1.67117 WP_004191674.1.67182 WP_004191674.1.67229 WP_004191674.1.67393 WP_004191674.1.67559 WP_004191674.1.6765 WP_004191674.1.67860 WP_004191674.1.67909 WP_004191674.1.67914 WP_004191674.1.67978 WP_004191674.1.6835 WP_004191674.1.68353 WP_004191674.1.68515 WP_004191674.1.68664 WP_004191674.1.68886 WP_004191674.1.68922 WP_004191674.1.69022 WP_004191674.1.69081 WP_004191674.1.69094 WP_004191674.1.69106 WP_004191674.1.69169 WP_004191674.1.69217 WP_004191674.1.69337 WP_004191674.1.69354 WP_004191674.1.69508 WP_004191674.1.69770 WP_004191674.1.69918 WP_004191674.1.70016 WP_004191674.1.7006 WP_004191674.1.70066 WP_004191674.1.70096 WP_004191674.1.70278 WP_004191674.1.70280 WP_004191674.1.70735 WP_004191674.1.71392 WP_004191674.1.71444 WP_004191674.1.71564 WP_004191674.1.71901 WP_004191674.1.72015 WP_004191674.1.72545 WP_004191674.1.72798 WP_004191674.1.72817 WP_004191674.1.73317 WP_004191674.1.73418 WP_004191674.1.73521 WP_004191674.1.73576 WP_004191674.1.73906 WP_004191674.1.73974 WP_004191674.1.74177 WP_004191674.1.74425 WP_004191674.1.7450 WP_004191674.1.74569 WP_004191674.1.74675 WP_004191674.1.74690 WP_004191674.1.75001 WP_004191674.1.75027 WP_004191674.1.75075 WP_004191674.1.75230 WP_004191674.1.75276 WP_004191674.1.75519 WP_004191674.1.75677 WP_004191674.1.75708 WP_004191674.1.75711 WP_004191674.1.75776 WP_004191674.1.75861 WP_004191674.1.75913 WP_004191674.1.75937 WP_004191674.1.76142 WP_004191674.1.76290 WP_004191674.1.76432 WP_004191674.1.76522 WP_004191674.1.76575 WP_004191674.1.766 WP_004191674.1.7703 WP_004191674.1.77249 WP_004191674.1.77287 WP_004191674.1.77319 WP_004191674.1.77689 WP_004191674.1.77788 WP_004191674.1.77845 WP_004191674.1.78029 WP_004191674.1.78278 WP_004191674.1.78506 WP_004191674.1.78557 WP_004191674.1.78628 WP_004191674.1.78807 WP_004191674.1.78827 WP_004191674.1.79052 WP_004191674.1.79360 WP_004191674.1.795 WP_004191674.1.79653 WP_004191674.1.79689 WP_004191674.1.79710 WP_004191674.1.79725 WP_004191674.1.79782 WP_004191674.1.80098 WP_004191674.1.80302 WP_004191674.1.80395 WP_004191674.1.80433 WP_004191674.1.80614 WP_004191674.1.80923 WP_004191674.1.81042 WP_004191674.1.8126 WP_004191674.1.81479 WP_004191674.1.81511 WP_004191674.1.81543 WP_004191674.1.81665 WP_004191674.1.82197 WP_004191674.1.82283 WP_004191674.1.82323 WP_004191674.1.82394 WP_004191674.1.82506 WP_004191674.1.82575 WP_004191674.1.82694 WP_004191674.1.82727 WP_004191674.1.82915 WP_004191674.1.82950 WP_004191674.1.83080 WP_004191674.1.83357 WP_004191674.1.8341 WP_004191674.1.83487 WP_004191674.1.83543 WP_004191674.1.83567 WP_004191674.1.83609 WP_004191674.1.83688 WP_004191674.1.8388 WP_004191674.1.8390 WP_004191674.1.8395 WP_004191674.1.83967 WP_004191674.1.84002 WP_004191674.1.84026 WP_004191674.1.84063 WP_004191674.1.84181 WP_004191674.1.84375 WP_004191674.1.84379 WP_004191674.1.84480 WP_004191674.1.84654 WP_004191674.1.84866 WP_004191674.1.85170 WP_004191674.1.85412 WP_004191674.1.85443 WP_004191674.1.85467 WP_004191674.1.85490 WP_004191674.1.85565 WP_004191674.1.85584 WP_004191674.1.856 WP_004191674.1.85641 WP_004191674.1.85645 WP_004191674.1.85774 WP_004191674.1.8629 WP_004191674.1.86295 WP_004191674.1.86438 WP_004191674.1.86525 WP_004191674.1.86806 WP_004191674.1.86872 WP_004191674.1.8697 WP_004191674.1.87114 WP_004191674.1.87278 WP_004191674.1.87324 WP_004191674.1.87553 WP_004191674.1.87652 WP_004191674.1.87759 WP_004191674.1.87811 WP_004191674.1.88003 WP_004191674.1.88117 WP_004191674.1.88168 WP_004191674.1.88237 WP_004191674.1.88322 WP_004191674.1.88369 WP_004191674.1.88411 WP_004191674.1.88666 WP_004191674.1.88682 WP_004191674.1.88764 WP_004191674.1.88920 WP_004191674.1.89093 WP_004191674.1.8912 WP_004191674.1.89240 WP_004191674.1.89435 WP_004191674.1.89514 WP_004191674.1.89782 WP_004191674.1.90079 WP_004191674.1.90471 WP_004191674.1.9079 WP_004191674.1.90934 WP_004191674.1.91025 WP_004191674.1.91142 WP_004191674.1.91198 WP_004191674.1.91700 WP_004191674.1.91709 WP_004191674.1.91763 WP_004191674.1.91823 WP_004191674.1.92095 WP_004191674.1.9236 WP_004191674.1.92367 WP_004191674.1.92406 WP_004191674.1.92430 WP_004191674.1.92493 WP_004191674.1.92507 WP_004191674.1.9280 WP_004191674.1.9281 WP_004191674.1.92904 WP_004191674.1.93844 WP_004191674.1.93845 WP_004191674.1.94023 WP_004191674.1.94050 WP_004191674.1.94117 WP_004191674.1.94121 WP_004191674.1.94286 WP_004191674.1.94403 WP_004191674.1.94498 WP_004191674.1.9479 WP_004191674.1.94901 WP_004191674.1.94926 WP_004191674.1.95300 WP_004191674.1.9537 WP_004191674.1.95420 WP_004191674.1.95587 WP_004191674.1.95644 WP_004191674.1.95672 WP_004191674.1.95938 WP_004191674.1.95952 WP_004191674.1.96660 WP_004191674.1.97058 WP_004191674.1.97112 WP_004191674.1.97148 WP_004191674.1.97989 WP_004191674.1.98066 WP_004191674.1.98218 WP_004191674.1.98316 WP_004191674.1.98491 WP_004191674.1.98547 WP_004191674.1.98688 WP_004191674.1.98713 WP_004191674.1.98753 WP_004191674.1.98768 WP_004191674.1.98944 WP_004191674.1.99061 WP_004191674.1.99069 WP_004191674.1.99160 WP_004191674.1.99233 WP_004191674.1.99290 WP_004191674.1.9962 WP_004191674.1.99629 WP_004191674.1.99741 WP_004191674.1.9975 WP_004191674.1.9983 WP_004191674.1.99890 WP_004191674.1.99919 YP_102925.1.87047 YP_108466.1.59693 gi|126439839|ref|YP_001058845.1| gi|526473332|ref|YP_008340576.1| gi|124385440|ref|YP_001026394.1| gi|556576045|ref|YP_008745906.1| gi|237812103|ref|YP_002896554.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]