SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126455577|ref|YP_001076302.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126455577|ref|YP_001076302.1|
Domain Number 1 Region: 70-309
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.76e-46
Family Phosphate binding protein-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126455577|ref|YP_001076302.1|
Sequence length 328
Comment cystine-binding periplasmic protein FliY [Burkholderia pseudomallei 1106a]
Sequence
MRREPPPQESSMKLPYTKSKSFAASLARAVVAFALAGIGAAAFAATFDLSPEQPGRVRGA
RDDAVIRALPASFKFVEPDTLTVGIAPSQPPISAYATDARTVVGFDADLAQLLADSLGRK
LKIVALAWPDWPLALESGRVDAVLSNVTVTEERKAKFDFSTYRKDQVGFYVKSDSKIASI
RQPRDVAGLRVITDAGTNQEKILLEWDRENVAHGLKPVTVQYYDDHAVKSVALQAGRADA
IFSVNSVLAYQAAQQHRTKLVGAVSGGWPRTADIAVTTRRGSGLAAPFTLAINGFIRNGT
YRRVLERWSLGSEAIDASRTNPPGLPKT
Download sequence
Identical sequences A0A0E1UV96 A0A0E1VWE0 A0A2K3EVZ3 A0A2K3FA49 A0A2K3G917 A0A2K3HEU3 A0A2K3I5A9 A3NM31 A3P7J2 A8EP66 B1H7U9 C4I7W6 Q3JKK4
WP_004525216.1.100195 WP_004525216.1.10047 WP_004525216.1.100583 WP_004525216.1.100720 WP_004525216.1.100825 WP_004525216.1.1010 WP_004525216.1.101307 WP_004525216.1.101559 WP_004525216.1.101588 WP_004525216.1.101783 WP_004525216.1.10269 WP_004525216.1.10290 WP_004525216.1.10359 WP_004525216.1.10553 WP_004525216.1.10633 WP_004525216.1.10746 WP_004525216.1.10907 WP_004525216.1.11046 WP_004525216.1.11072 WP_004525216.1.11160 WP_004525216.1.11268 WP_004525216.1.11404 WP_004525216.1.11747 WP_004525216.1.11825 WP_004525216.1.11893 WP_004525216.1.11998 WP_004525216.1.1266 WP_004525216.1.12731 WP_004525216.1.12793 WP_004525216.1.12856 WP_004525216.1.12860 WP_004525216.1.13520 WP_004525216.1.13597 WP_004525216.1.13639 WP_004525216.1.13950 WP_004525216.1.14356 WP_004525216.1.14539 WP_004525216.1.14557 WP_004525216.1.14660 WP_004525216.1.15170 WP_004525216.1.15364 WP_004525216.1.15525 WP_004525216.1.15673 WP_004525216.1.15696 WP_004525216.1.16249 WP_004525216.1.16540 WP_004525216.1.16561 WP_004525216.1.16625 WP_004525216.1.16680 WP_004525216.1.16689 WP_004525216.1.16749 WP_004525216.1.17068 WP_004525216.1.17278 WP_004525216.1.18396 WP_004525216.1.18405 WP_004525216.1.18471 WP_004525216.1.18631 WP_004525216.1.18669 WP_004525216.1.18704 WP_004525216.1.18744 WP_004525216.1.18868 WP_004525216.1.18906 WP_004525216.1.19401 WP_004525216.1.19486 WP_004525216.1.19540 WP_004525216.1.19629 WP_004525216.1.19842 WP_004525216.1.19854 WP_004525216.1.20021 WP_004525216.1.20246 WP_004525216.1.20520 WP_004525216.1.20954 WP_004525216.1.21147 WP_004525216.1.21205 WP_004525216.1.21291 WP_004525216.1.21304 WP_004525216.1.21461 WP_004525216.1.21653 WP_004525216.1.21907 WP_004525216.1.22046 WP_004525216.1.22299 WP_004525216.1.2261 WP_004525216.1.23104 WP_004525216.1.23131 WP_004525216.1.23743 WP_004525216.1.23852 WP_004525216.1.24020 WP_004525216.1.24134 WP_004525216.1.24314 WP_004525216.1.24372 WP_004525216.1.24454 WP_004525216.1.24513 WP_004525216.1.24701 WP_004525216.1.25068 WP_004525216.1.25102 WP_004525216.1.25138 WP_004525216.1.25628 WP_004525216.1.25728 WP_004525216.1.259 WP_004525216.1.26054 WP_004525216.1.26502 WP_004525216.1.26535 WP_004525216.1.26565 WP_004525216.1.26633 WP_004525216.1.26645 WP_004525216.1.267 WP_004525216.1.26838 WP_004525216.1.26849 WP_004525216.1.27064 WP_004525216.1.27069 WP_004525216.1.27363 WP_004525216.1.27390 WP_004525216.1.27399 WP_004525216.1.27420 WP_004525216.1.27597 WP_004525216.1.27810 WP_004525216.1.27909 WP_004525216.1.28018 WP_004525216.1.28187 WP_004525216.1.28632 WP_004525216.1.29178 WP_004525216.1.29335 WP_004525216.1.29405 WP_004525216.1.29508 WP_004525216.1.29520 WP_004525216.1.29547 WP_004525216.1.29658 WP_004525216.1.29853 WP_004525216.1.29878 WP_004525216.1.29887 WP_004525216.1.29899 WP_004525216.1.29948 WP_004525216.1.30671 WP_004525216.1.30937 WP_004525216.1.31343 WP_004525216.1.31723 WP_004525216.1.32174 WP_004525216.1.32182 WP_004525216.1.32581 WP_004525216.1.3273 WP_004525216.1.32951 WP_004525216.1.33087 WP_004525216.1.33157 WP_004525216.1.332 WP_004525216.1.33366 WP_004525216.1.33573 WP_004525216.1.33779 WP_004525216.1.34230 WP_004525216.1.34393 WP_004525216.1.34564 WP_004525216.1.35025 WP_004525216.1.35090 WP_004525216.1.35141 WP_004525216.1.35227 WP_004525216.1.35249 WP_004525216.1.35474 WP_004525216.1.35485 WP_004525216.1.35491 WP_004525216.1.35825 WP_004525216.1.36106 WP_004525216.1.36174 WP_004525216.1.36259 WP_004525216.1.36527 WP_004525216.1.366 WP_004525216.1.36662 WP_004525216.1.36666 WP_004525216.1.36944 WP_004525216.1.37 WP_004525216.1.3706 WP_004525216.1.37373 WP_004525216.1.37428 WP_004525216.1.37517 WP_004525216.1.37519 WP_004525216.1.37535 WP_004525216.1.37581 WP_004525216.1.37622 WP_004525216.1.37627 WP_004525216.1.37690 WP_004525216.1.37702 WP_004525216.1.37725 WP_004525216.1.37806 WP_004525216.1.37994 WP_004525216.1.38442 WP_004525216.1.38490 WP_004525216.1.3872 WP_004525216.1.38810 WP_004525216.1.39078 WP_004525216.1.39162 WP_004525216.1.39179 WP_004525216.1.3947 WP_004525216.1.39595 WP_004525216.1.39757 WP_004525216.1.40045 WP_004525216.1.40275 WP_004525216.1.40388 WP_004525216.1.40390 WP_004525216.1.40448 WP_004525216.1.41945 WP_004525216.1.42408 WP_004525216.1.42492 WP_004525216.1.42496 WP_004525216.1.42800 WP_004525216.1.43136 WP_004525216.1.43156 WP_004525216.1.43373 WP_004525216.1.43542 WP_004525216.1.43587 WP_004525216.1.43727 WP_004525216.1.43786 WP_004525216.1.44234 WP_004525216.1.44352 WP_004525216.1.44414 WP_004525216.1.45284 WP_004525216.1.45348 WP_004525216.1.45356 WP_004525216.1.45537 WP_004525216.1.45715 WP_004525216.1.45890 WP_004525216.1.4631 WP_004525216.1.46757 WP_004525216.1.4693 WP_004525216.1.47086 WP_004525216.1.4718 WP_004525216.1.47564 WP_004525216.1.48093 WP_004525216.1.48464 WP_004525216.1.49717 WP_004525216.1.49872 WP_004525216.1.50174 WP_004525216.1.50401 WP_004525216.1.50636 WP_004525216.1.50788 WP_004525216.1.50839 WP_004525216.1.51666 WP_004525216.1.5182 WP_004525216.1.51874 WP_004525216.1.51891 WP_004525216.1.52229 WP_004525216.1.52365 WP_004525216.1.52407 WP_004525216.1.52547 WP_004525216.1.52643 WP_004525216.1.52655 WP_004525216.1.52731 WP_004525216.1.52760 WP_004525216.1.52882 WP_004525216.1.5292 WP_004525216.1.53048 WP_004525216.1.53103 WP_004525216.1.53132 WP_004525216.1.5338 WP_004525216.1.53578 WP_004525216.1.54016 WP_004525216.1.5413 WP_004525216.1.54312 WP_004525216.1.54369 WP_004525216.1.54859 WP_004525216.1.55038 WP_004525216.1.55415 WP_004525216.1.5608 WP_004525216.1.56126 WP_004525216.1.56248 WP_004525216.1.5641 WP_004525216.1.56458 WP_004525216.1.56591 WP_004525216.1.56744 WP_004525216.1.56949 WP_004525216.1.57046 WP_004525216.1.57096 WP_004525216.1.57247 WP_004525216.1.5734 WP_004525216.1.57341 WP_004525216.1.58405 WP_004525216.1.58509 WP_004525216.1.58523 WP_004525216.1.58578 WP_004525216.1.58639 WP_004525216.1.58758 WP_004525216.1.5883 WP_004525216.1.59103 WP_004525216.1.59200 WP_004525216.1.59255 WP_004525216.1.59422 WP_004525216.1.59496 WP_004525216.1.59519 WP_004525216.1.59549 WP_004525216.1.59747 WP_004525216.1.60398 WP_004525216.1.60810 WP_004525216.1.60836 WP_004525216.1.61084 WP_004525216.1.61202 WP_004525216.1.61455 WP_004525216.1.61723 WP_004525216.1.61854 WP_004525216.1.6186 WP_004525216.1.61900 WP_004525216.1.62103 WP_004525216.1.62183 WP_004525216.1.63261 WP_004525216.1.63361 WP_004525216.1.63379 WP_004525216.1.63661 WP_004525216.1.63942 WP_004525216.1.64068 WP_004525216.1.64096 WP_004525216.1.64166 WP_004525216.1.64364 WP_004525216.1.64383 WP_004525216.1.64542 WP_004525216.1.64892 WP_004525216.1.65093 WP_004525216.1.65468 WP_004525216.1.65832 WP_004525216.1.65994 WP_004525216.1.66380 WP_004525216.1.67013 WP_004525216.1.67117 WP_004525216.1.67229 WP_004525216.1.67559 WP_004525216.1.6765 WP_004525216.1.67860 WP_004525216.1.67909 WP_004525216.1.67914 WP_004525216.1.67978 WP_004525216.1.6835 WP_004525216.1.68922 WP_004525216.1.69022 WP_004525216.1.69081 WP_004525216.1.69094 WP_004525216.1.69106 WP_004525216.1.69217 WP_004525216.1.69354 WP_004525216.1.69770 WP_004525216.1.70016 WP_004525216.1.7006 WP_004525216.1.70066 WP_004525216.1.70278 WP_004525216.1.70735 WP_004525216.1.71444 WP_004525216.1.71564 WP_004525216.1.71901 WP_004525216.1.72015 WP_004525216.1.72817 WP_004525216.1.73418 WP_004525216.1.73521 WP_004525216.1.73906 WP_004525216.1.73974 WP_004525216.1.74425 WP_004525216.1.74569 WP_004525216.1.74690 WP_004525216.1.75276 WP_004525216.1.75519 WP_004525216.1.75677 WP_004525216.1.75708 WP_004525216.1.75711 WP_004525216.1.75913 WP_004525216.1.75937 WP_004525216.1.76142 WP_004525216.1.76290 WP_004525216.1.76432 WP_004525216.1.766 WP_004525216.1.7703 WP_004525216.1.77249 WP_004525216.1.77287 WP_004525216.1.77319 WP_004525216.1.77689 WP_004525216.1.77788 WP_004525216.1.77845 WP_004525216.1.78029 WP_004525216.1.78278 WP_004525216.1.78628 WP_004525216.1.78807 WP_004525216.1.79052 WP_004525216.1.79360 WP_004525216.1.795 WP_004525216.1.79689 WP_004525216.1.79710 WP_004525216.1.79782 WP_004525216.1.80098 WP_004525216.1.80302 WP_004525216.1.80433 WP_004525216.1.80614 WP_004525216.1.80923 WP_004525216.1.81042 WP_004525216.1.8126 WP_004525216.1.81479 WP_004525216.1.81543 WP_004525216.1.82197 WP_004525216.1.82394 WP_004525216.1.82506 WP_004525216.1.82575 WP_004525216.1.82694 WP_004525216.1.82727 WP_004525216.1.82915 WP_004525216.1.83080 WP_004525216.1.83357 WP_004525216.1.8341 WP_004525216.1.83487 WP_004525216.1.83543 WP_004525216.1.83567 WP_004525216.1.83609 WP_004525216.1.83688 WP_004525216.1.8388 WP_004525216.1.8390 WP_004525216.1.8395 WP_004525216.1.84002 WP_004525216.1.84026 WP_004525216.1.84181 WP_004525216.1.84379 WP_004525216.1.84654 WP_004525216.1.84866 WP_004525216.1.85412 WP_004525216.1.85467 WP_004525216.1.85565 WP_004525216.1.856 WP_004525216.1.85641 WP_004525216.1.85774 WP_004525216.1.8585 WP_004525216.1.8629 WP_004525216.1.86295 WP_004525216.1.86438 WP_004525216.1.86525 WP_004525216.1.86806 WP_004525216.1.87114 WP_004525216.1.87278 WP_004525216.1.87324 WP_004525216.1.87652 WP_004525216.1.87759 WP_004525216.1.88237 WP_004525216.1.88322 WP_004525216.1.88369 WP_004525216.1.88666 WP_004525216.1.88682 WP_004525216.1.88764 WP_004525216.1.88920 WP_004525216.1.8912 WP_004525216.1.89240 WP_004525216.1.89435 WP_004525216.1.89782 WP_004525216.1.90079 WP_004525216.1.90471 WP_004525216.1.9079 WP_004525216.1.90934 WP_004525216.1.91025 WP_004525216.1.91142 WP_004525216.1.91198 WP_004525216.1.91700 WP_004525216.1.91709 WP_004525216.1.91763 WP_004525216.1.91823 WP_004525216.1.92095 WP_004525216.1.92406 WP_004525216.1.92430 WP_004525216.1.92493 WP_004525216.1.9280 WP_004525216.1.93845 WP_004525216.1.94023 WP_004525216.1.9479 WP_004525216.1.94901 WP_004525216.1.94926 WP_004525216.1.95300 WP_004525216.1.95339 WP_004525216.1.9537 WP_004525216.1.95420 WP_004525216.1.95587 WP_004525216.1.95644 WP_004525216.1.95672 WP_004525216.1.95938 WP_004525216.1.97058 WP_004525216.1.97112 WP_004525216.1.97989 WP_004525216.1.98218 WP_004525216.1.98316 WP_004525216.1.98547 WP_004525216.1.98713 WP_004525216.1.98753 WP_004525216.1.98768 WP_004525216.1.98944 WP_004525216.1.99069 WP_004525216.1.99160 WP_004525216.1.99233 WP_004525216.1.9962 WP_004525216.1.99629 WP_004525216.1.99741 WP_004525216.1.9975 WP_004525216.1.9983 WP_004525216.1.99890 WP_004525216.1.99919 320372.BURPS1710b_A0740 320373.BURPS668_A2408 357348.BURPS1106A_A2269 gi|126455577|ref|YP_001076302.1| gi|76817561|ref|YP_335899.1| gi|126443870|ref|YP_001063402.1| gi|403523525|ref|YP_006659094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]