SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126455702|ref|YP_001075307.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126455702|ref|YP_001075307.1|
Domain Number 1 Region: 34-313
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.35e-51
Family Phosphate binding protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126455702|ref|YP_001075307.1|
Sequence length 327
Comment aliphatic sulfonate ABC transporter substrate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MIRPARWFARTVTAALASLCVASAFAQDAAGDKVLRVGYQKAGLLAVVKAQGTLETRVKP
LGYTVKWFEFPAGPQLLEALNADSVDIGYTGAPPAVFAQASGVRFVYVGAEPPSPHNEAI
VVKADSPLRRVADLRGRKVALQKGSSANYLLLEALRQAGVRYDEIRPIYLPPADARAAFE
SGTVDAWVVWDPYYAAAQHALKARTLADYTGLSATYNFYEATRDFATRHPDVVGAVLQQL
RETGLWVNAHSAETAALIAPKIGLDRALVETWVKRVPYGTTPLDDKIVASQQRVADAFLA
AKLIPRKLTVADNVWTERRAADALAAK
Download sequence
Identical sequences A0A069B8R6 A0A0F6L356 A0A0H2WCS2 A0A290YGM4 A2RXF3 A3P4P7 B1H5S8 Q3JFH5
gi|121596836|ref|YP_989897.1| gi|403522569|ref|YP_006658138.1| 243160.BMAA1303 320372.BURPS1710b_A2528 320388.BMASAVP1_0286 320389.BMA10247_A1012 357348.BURPS1106A_A1272 412022.BMA10229_0556 WP_004199695.1.100104 WP_004199695.1.100720 WP_004199695.1.100727 WP_004199695.1.1010 WP_004199695.1.101381 WP_004199695.1.101559 WP_004199695.1.101588 WP_004199695.1.10269 WP_004199695.1.10553 WP_004199695.1.10633 WP_004199695.1.10746 WP_004199695.1.1098 WP_004199695.1.11404 WP_004199695.1.11825 WP_004199695.1.11893 WP_004199695.1.12793 WP_004199695.1.12856 WP_004199695.1.12860 WP_004199695.1.13504 WP_004199695.1.13597 WP_004199695.1.13639 WP_004199695.1.13925 WP_004199695.1.14660 WP_004199695.1.15170 WP_004199695.1.15364 WP_004199695.1.15525 WP_004199695.1.15696 WP_004199695.1.16249 WP_004199695.1.16358 WP_004199695.1.16561 WP_004199695.1.16689 WP_004199695.1.16749 WP_004199695.1.17067 WP_004199695.1.17068 WP_004199695.1.17278 WP_004199695.1.18405 WP_004199695.1.18704 WP_004199695.1.18744 WP_004199695.1.18906 WP_004199695.1.19486 WP_004199695.1.19842 WP_004199695.1.20021 WP_004199695.1.20246 WP_004199695.1.20501 WP_004199695.1.20520 WP_004199695.1.20531 WP_004199695.1.20673 WP_004199695.1.21147 WP_004199695.1.21205 WP_004199695.1.21409 WP_004199695.1.21442 WP_004199695.1.21461 WP_004199695.1.21809 WP_004199695.1.22046 WP_004199695.1.22308 WP_004199695.1.22329 WP_004199695.1.2261 WP_004199695.1.22625 WP_004199695.1.22779 WP_004199695.1.23104 WP_004199695.1.2317 WP_004199695.1.23385 WP_004199695.1.23743 WP_004199695.1.23994 WP_004199695.1.24314 WP_004199695.1.24454 WP_004199695.1.24701 WP_004199695.1.25068 WP_004199695.1.25265 WP_004199695.1.25628 WP_004199695.1.26445 WP_004199695.1.26502 WP_004199695.1.26535 WP_004199695.1.26645 WP_004199695.1.267 WP_004199695.1.26849 WP_004199695.1.27064 WP_004199695.1.27069 WP_004199695.1.27390 WP_004199695.1.27399 WP_004199695.1.27597 WP_004199695.1.27909 WP_004199695.1.28018 WP_004199695.1.28453 WP_004199695.1.28619 WP_004199695.1.29148 WP_004199695.1.29335 WP_004199695.1.29508 WP_004199695.1.29520 WP_004199695.1.29547 WP_004199695.1.29658 WP_004199695.1.29878 WP_004199695.1.29887 WP_004199695.1.29899 WP_004199695.1.30382 WP_004199695.1.30966 WP_004199695.1.31723 WP_004199695.1.31831 WP_004199695.1.32174 WP_004199695.1.32182 WP_004199695.1.3251 WP_004199695.1.3273 WP_004199695.1.33077 WP_004199695.1.33157 WP_004199695.1.332 WP_004199695.1.33366 WP_004199695.1.33419 WP_004199695.1.33543 WP_004199695.1.33573 WP_004199695.1.33779 WP_004199695.1.34393 WP_004199695.1.34564 WP_004199695.1.34747 WP_004199695.1.35090 WP_004199695.1.35249 WP_004199695.1.35474 WP_004199695.1.35485 WP_004199695.1.35491 WP_004199695.1.35757 WP_004199695.1.35825 WP_004199695.1.35878 WP_004199695.1.36106 WP_004199695.1.36259 WP_004199695.1.36527 WP_004199695.1.366 WP_004199695.1.36666 WP_004199695.1.3706 WP_004199695.1.37428 WP_004199695.1.37446 WP_004199695.1.37581 WP_004199695.1.37622 WP_004199695.1.37702 WP_004199695.1.37725 WP_004199695.1.38115 WP_004199695.1.38442 WP_004199695.1.38490 WP_004199695.1.3872 WP_004199695.1.38810 WP_004199695.1.38946 WP_004199695.1.39078 WP_004199695.1.39162 WP_004199695.1.39179 WP_004199695.1.39349 WP_004199695.1.39595 WP_004199695.1.39757 WP_004199695.1.40021 WP_004199695.1.40191 WP_004199695.1.40235 WP_004199695.1.40275 WP_004199695.1.40388 WP_004199695.1.40390 WP_004199695.1.41477 WP_004199695.1.41588 WP_004199695.1.42408 WP_004199695.1.43136 WP_004199695.1.43156 WP_004199695.1.43373 WP_004199695.1.43542 WP_004199695.1.43587 WP_004199695.1.43786 WP_004199695.1.43899 WP_004199695.1.44352 WP_004199695.1.44414 WP_004199695.1.44540 WP_004199695.1.45284 WP_004199695.1.45537 WP_004199695.1.45715 WP_004199695.1.4631 WP_004199695.1.46757 WP_004199695.1.4693 WP_004199695.1.47086 WP_004199695.1.47149 WP_004199695.1.47564 WP_004199695.1.48093 WP_004199695.1.4810 WP_004199695.1.48313 WP_004199695.1.48407 WP_004199695.1.48464 WP_004199695.1.49717 WP_004199695.1.49872 WP_004199695.1.50174 WP_004199695.1.51666 WP_004199695.1.5173 WP_004199695.1.51874 WP_004199695.1.51891 WP_004199695.1.52229 WP_004199695.1.52365 WP_004199695.1.52643 WP_004199695.1.52731 WP_004199695.1.53048 WP_004199695.1.53977 WP_004199695.1.54016 WP_004199695.1.5413 WP_004199695.1.54859 WP_004199695.1.54892 WP_004199695.1.55691 WP_004199695.1.55755 WP_004199695.1.5641 WP_004199695.1.56451 WP_004199695.1.57247 WP_004199695.1.57341 WP_004199695.1.57679 WP_004199695.1.58003 WP_004199695.1.58355 WP_004199695.1.58362 WP_004199695.1.58390 WP_004199695.1.58405 WP_004199695.1.58509 WP_004199695.1.58523 WP_004199695.1.58758 WP_004199695.1.59200 WP_004199695.1.59422 WP_004199695.1.59496 WP_004199695.1.59549 WP_004199695.1.59747 WP_004199695.1.60810 WP_004199695.1.60969 WP_004199695.1.61073 WP_004199695.1.61084 WP_004199695.1.61202 WP_004199695.1.61455 WP_004199695.1.61588 WP_004199695.1.61723 WP_004199695.1.6186 WP_004199695.1.62183 WP_004199695.1.62774 WP_004199695.1.63439 WP_004199695.1.63942 WP_004199695.1.64166 WP_004199695.1.64364 WP_004199695.1.64683 WP_004199695.1.65270 WP_004199695.1.65468 WP_004199695.1.65994 WP_004199695.1.66321 WP_004199695.1.66465 WP_004199695.1.66594 WP_004199695.1.67013 WP_004199695.1.67117 WP_004199695.1.67182 WP_004199695.1.67229 WP_004199695.1.67393 WP_004199695.1.67559 WP_004199695.1.6765 WP_004199695.1.67860 WP_004199695.1.6835 WP_004199695.1.68353 WP_004199695.1.69022 WP_004199695.1.69169 WP_004199695.1.69217 WP_004199695.1.69337 WP_004199695.1.69508 WP_004199695.1.69770 WP_004199695.1.7006 WP_004199695.1.70066 WP_004199695.1.70278 WP_004199695.1.71444 WP_004199695.1.71564 WP_004199695.1.71901 WP_004199695.1.72545 WP_004199695.1.72798 WP_004199695.1.72817 WP_004199695.1.73317 WP_004199695.1.73418 WP_004199695.1.73906 WP_004199695.1.73974 WP_004199695.1.74425 WP_004199695.1.74569 WP_004199695.1.74675 WP_004199695.1.74690 WP_004199695.1.75027 WP_004199695.1.75230 WP_004199695.1.75677 WP_004199695.1.75711 WP_004199695.1.75776 WP_004199695.1.75861 WP_004199695.1.75913 WP_004199695.1.75937 WP_004199695.1.76142 WP_004199695.1.76432 WP_004199695.1.766 WP_004199695.1.77249 WP_004199695.1.77287 WP_004199695.1.77319 WP_004199695.1.77689 WP_004199695.1.77788 WP_004199695.1.78029 WP_004199695.1.78278 WP_004199695.1.78557 WP_004199695.1.78628 WP_004199695.1.78827 WP_004199695.1.79052 WP_004199695.1.79653 WP_004199695.1.79689 WP_004199695.1.79710 WP_004199695.1.80302 WP_004199695.1.80433 WP_004199695.1.80923 WP_004199695.1.81042 WP_004199695.1.8126 WP_004199695.1.81479 WP_004199695.1.81543 WP_004199695.1.82283 WP_004199695.1.82727 WP_004199695.1.82915 WP_004199695.1.83080 WP_004199695.1.83357 WP_004199695.1.8341 WP_004199695.1.83487 WP_004199695.1.83543 WP_004199695.1.83609 WP_004199695.1.83688 WP_004199695.1.8390 WP_004199695.1.83967 WP_004199695.1.84002 WP_004199695.1.84026 WP_004199695.1.84063 WP_004199695.1.84181 WP_004199695.1.84480 WP_004199695.1.84654 WP_004199695.1.85412 WP_004199695.1.85565 WP_004199695.1.856 WP_004199695.1.85645 WP_004199695.1.85774 WP_004199695.1.8629 WP_004199695.1.86438 WP_004199695.1.86525 WP_004199695.1.86806 WP_004199695.1.87114 WP_004199695.1.87278 WP_004199695.1.87324 WP_004199695.1.87652 WP_004199695.1.87759 WP_004199695.1.88237 WP_004199695.1.88322 WP_004199695.1.88369 WP_004199695.1.88666 WP_004199695.1.88764 WP_004199695.1.88920 WP_004199695.1.89093 WP_004199695.1.8912 WP_004199695.1.89240 WP_004199695.1.89435 WP_004199695.1.89782 WP_004199695.1.90079 WP_004199695.1.90471 WP_004199695.1.9079 WP_004199695.1.91025 WP_004199695.1.91142 WP_004199695.1.91763 WP_004199695.1.91823 WP_004199695.1.92095 WP_004199695.1.9236 WP_004199695.1.92406 WP_004199695.1.92430 WP_004199695.1.92507 WP_004199695.1.9281 WP_004199695.1.94023 WP_004199695.1.94050 WP_004199695.1.94286 WP_004199695.1.94403 WP_004199695.1.94901 WP_004199695.1.95300 WP_004199695.1.95420 WP_004199695.1.95587 WP_004199695.1.95644 WP_004199695.1.95952 WP_004199695.1.96660 WP_004199695.1.97112 WP_004199695.1.97148 WP_004199695.1.97989 WP_004199695.1.98066 WP_004199695.1.98218 WP_004199695.1.98316 WP_004199695.1.98547 WP_004199695.1.98753 WP_004199695.1.98768 WP_004199695.1.99069 WP_004199695.1.99160 WP_004199695.1.99233 WP_004199695.1.9962 WP_004199695.1.99629 WP_004199695.1.99741 WP_004199695.1.9983 WP_004199695.1.99890 YP_105924.1.87047 gi|126455702|ref|YP_001075307.1| gi|526458923|ref|YP_008328000.1| gi|53716910|ref|YP_105924.1| gi|76819225|ref|YP_337678.1| gi|126447467|ref|YP_001078204.1| gi|124381504|ref|YP_001024372.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]