SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126455720|ref|YP_001075964.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126455720|ref|YP_001075964.1|
Domain Number 1 Region: 41-313
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.99e-80
Family Phosphate binding protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126455720|ref|YP_001075964.1|
Sequence length 328
Comment glycine betaine/L-proline ABC transporter periplasmic glycine betaine/L-proline-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MLTTSLMMRRSTMKRNLIAAACGLAIAAAPFASARAGDAPTCKAVRFADVGWTDIAATTG
LASTMLAGLGYAPTKTIASVPITFAGIKSKQIDVFLGYWSPTMDPMIAPFTKAGTIKVLA
APNLTGAKYTLAVPDYVYQGGLKSFADIQKYADKLNGRIYGIEPGNDGNALIKKMIDGNQ
FGLGKFKLVESSEAGMLVEVNRAIRDKQWIVFLGWEPHPMNVQMKIDYLSGGDDVFGPNY
GEAKVLTATPPDYAARCPNVAKFVSNLQFTTSIENHVMLPIMNKEDPNKAAAEWLKANPQ
SLDKWLAGVTTFDGKPGLPAVKHYLGIQ
Download sequence
Identical sequences A0A0E1UD74 A0A0E1VUI8 A2RYE5 A3P6K4 A8EPY3
gi|124381680|ref|YP_001024714.1| gi|126455720|ref|YP_001075964.1| 357348.BURPS1106A_A1930 412022.BMA10229_0899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]