SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126456143|ref|YP_001074141.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126456143|ref|YP_001074141.1|
Domain Number 1 Region: 20-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.49e-74
Family Phosphate binding protein-like 0.00000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126456143|ref|YP_001074141.1|
Sequence length 343
Comment ABC transport system, exported substrate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MKKVVGAMLLLAVGHAVSAELHIGSWPDYLPDTLIKKFQAETGIKTTLDTYASDAALTQK
LQSGGGGYDVVIAGDYYVPVLVKSGLLQKLDKNKLPNIANIKPEYRHPSFDPQRDYAMPY
TVVLTGFAYDSARVSGGKLDESWKSFFDPPAQLRGQIGDLDVEEELYMAASWYLGQDECT
ENPADAKRVLDVLQKQKPFVKTYSNDGTIDRLASKQIAVQHIWSGAAARAQDRLPSITFV
YPREGVRLFMDSLLIPAKAQNTASAYQFVNWMMRPENIAQVTNAVRYNNEIIGSERYIDA
ALLKNSAIKTPEQYKIRLRPYKICSPAAIQLRNKVWLKLKGNR
Download sequence
Identical sequences A0A0E1VWD7 A0A0H3HQ47 A0A1X4JUN8 A3P1D1 A8EJU2
357348.BURPS1106A_A0098 WP_004529613.1.101307 WP_004529613.1.10359 WP_004529613.1.10907 WP_004529613.1.1098 WP_004529613.1.11996 WP_004529613.1.12793 WP_004529613.1.12856 WP_004529613.1.13309 WP_004529613.1.14539 WP_004529613.1.16249 WP_004529613.1.16358 WP_004529613.1.16625 WP_004529613.1.16680 WP_004529613.1.17473 WP_004529613.1.18405 WP_004529613.1.18704 WP_004529613.1.18744 WP_004529613.1.18868 WP_004529613.1.18906 WP_004529613.1.21291 WP_004529613.1.21461 WP_004529613.1.23009 WP_004529613.1.23994 WP_004529613.1.2462 WP_004529613.1.25412 WP_004529613.1.27069 WP_004529613.1.27390 WP_004529613.1.27420 WP_004529613.1.28066 WP_004529613.1.28187 WP_004529613.1.29405 WP_004529613.1.29853 WP_004529613.1.29887 WP_004529613.1.30671 WP_004529613.1.30937 WP_004529613.1.30966 WP_004529613.1.32174 WP_004529613.1.324 WP_004529613.1.33077 WP_004529613.1.33157 WP_004529613.1.35141 WP_004529613.1.35227 WP_004529613.1.35491 WP_004529613.1.36174 WP_004529613.1.36666 WP_004529613.1.36944 WP_004529613.1.37446 WP_004529613.1.37519 WP_004529613.1.37627 WP_004529613.1.37690 WP_004529613.1.38442 WP_004529613.1.38490 WP_004529613.1.38683 WP_004529613.1.3872 WP_004529613.1.39078 WP_004529613.1.39179 WP_004529613.1.39898 WP_004529613.1.42408 WP_004529613.1.42496 WP_004529613.1.43156 WP_004529613.1.43786 WP_004529613.1.44234 WP_004529613.1.46757 WP_004529613.1.46969 WP_004529613.1.47086 WP_004529613.1.4718 WP_004529613.1.48464 WP_004529613.1.50788 WP_004529613.1.5173 WP_004529613.1.5292 WP_004529613.1.53132 WP_004529613.1.53578 WP_004529613.1.54859 WP_004529613.1.5608 WP_004529613.1.56949 WP_004529613.1.57247 WP_004529613.1.57359 WP_004529613.1.58003 WP_004529613.1.58355 WP_004529613.1.58390 WP_004529613.1.58405 WP_004529613.1.58578 WP_004529613.1.5883 WP_004529613.1.59422 WP_004529613.1.59536 WP_004529613.1.60810 WP_004529613.1.60836 WP_004529613.1.61685 WP_004529613.1.62774 WP_004529613.1.63097 WP_004529613.1.64364 WP_004529613.1.64383 WP_004529613.1.65270 WP_004529613.1.65994 WP_004529613.1.66465 WP_004529613.1.67860 WP_004529613.1.67914 WP_004529613.1.69169 WP_004529613.1.70278 WP_004529613.1.71392 WP_004529613.1.71901 WP_004529613.1.74177 WP_004529613.1.74425 WP_004529613.1.75027 WP_004529613.1.75677 WP_004529613.1.76142 WP_004529613.1.76290 WP_004529613.1.766 WP_004529613.1.78029 WP_004529613.1.79782 WP_004529613.1.80433 WP_004529613.1.80614 WP_004529613.1.81042 WP_004529613.1.81543 WP_004529613.1.82394 WP_004529613.1.82694 WP_004529613.1.83357 WP_004529613.1.8341 WP_004529613.1.83487 WP_004529613.1.83543 WP_004529613.1.83688 WP_004529613.1.8390 WP_004529613.1.84026 WP_004529613.1.84375 WP_004529613.1.84379 WP_004529613.1.84866 WP_004529613.1.85443 WP_004529613.1.86438 WP_004529613.1.86525 WP_004529613.1.86806 WP_004529613.1.87278 WP_004529613.1.87553 WP_004529613.1.88237 WP_004529613.1.91025 WP_004529613.1.91709 WP_004529613.1.92367 WP_004529613.1.92507 WP_004529613.1.94498 WP_004529613.1.95054 WP_004529613.1.95339 WP_004529613.1.95938 WP_004529613.1.97058 WP_004529613.1.98753 WP_004529613.1.98768 WP_004529613.1.9962 gi|386863814|ref|YP_006276762.1| gi|126456143|ref|YP_001074141.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]