SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126456403|ref|YP_001074414.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126456403|ref|YP_001074414.1|
Domain Number 1 Region: 21-259
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.42e-83
Family Phosphate binding protein-like 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126456403|ref|YP_001074414.1|
Sequence length 259
Comment YaeC family lipoprotein [Burkholderia pseudomallei 1106a]
Sequence
MAGGAVWALAATLAHAGGPALKIGTMSGPDAQIWAEVTKVAARDGLAIKVIEFNDYVQPN
AALDAGDLDANGFQHQPFLDSQIRQRGYRIVNVGLTYTSPMGFYSKRLKSLKDLPVGAKV
GIQNDPSNGNRALLLLQKYGIVKLKPGAGVNGVNATPLDVAENPRKIRLVELDAAQLPRA
LPDLDAASINTDYAVKAGLSPVKDAIAIEDLKGPYANLIAVRAQDKDKPWVKKLVAAYES
NDVRKFIETKFNGAIIPAF
Download sequence
Identical sequences A0A095LV43 A0A0E1UQ58 A0A0F6LG35 A3NGK3 A3P254 B1HCQ6 C4AWF5 C4I6W4
gi|126443864|ref|YP_001061474.1| gi|556572622|ref|YP_008741918.1| 320373.BURPS668_A0468 357348.BURPS1106A_A0371 gi|126456403|ref|YP_001074414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]