SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126456762|ref|YP_001074529.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126456762|ref|YP_001074529.1|
Domain Number 1 Region: 37-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-57
Family Phosphate binding protein-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126456762|ref|YP_001074529.1|
Sequence length 360
Comment 2-aminoethylphosphonate ABC transporter periplasmic 2-aminoethylphosphonate-binding protein [Burkholderia pseudomallei 1106a]
Sequence
MTYTNFPRGGAWRRFALAAGAAALLQGAAAQAQAAAVVLYTADGLENLYRDVLPAFEKQE
GVKVNIVTAGSGEVVNRANVEKGSPKADVIVTLPPFIQQAGQFGLLQPYRSVNYKNVPAI
AKAEDGSWATFVNNYFSFAINPSVVKSQPKTFADLLHPDYSGKLAYSNPATAGDGMAVII
LTSALMGEDKAFDYLAKLERSVKFHTKGTGYLNVLLSRNEIAVANGDLQMDLDDAEHGGL
SIKPIFVAAKAGEPPTTFQLPYAIGLVKGGPNQDAGRKLIDYLMSADVQAKVPDMFGIPG
RTDVPLSGKNGEAVKRAIAGVKLIPVDWDAVMAKKPVWTERWKKEVIGDSGKQTEVVKPK
Download sequence
Identical sequences A0A095STF9 A0A0E1S1E2 A0A0E1UBR1 A0A0E1VZ92 A0A0F6G4V8 A0A0F6LFL0 A0A290YHG6 A3P2G9 A8EIP9 B1HC04 C4B3M9 C4I7L6 Q3JH96 Q63NF5
272560.BPSS0344 320372.BURPS1710b_A1900 320388.BMASAVP1_1758 320389.BMA10247_A0896 357348.BURPS1106A_A0487 412022.BMA10229_2212 gi|53721379|ref|YP_110364.1| gi|124381235|ref|YP_001026004.1| gi|76819199|ref|YP_337057.1| WP_004194640.1.100104 WP_004194640.1.100583 WP_004194640.1.100720 WP_004194640.1.100727 WP_004194640.1.100825 WP_004194640.1.100900 WP_004194640.1.101060 WP_004194640.1.101307 WP_004194640.1.101783 WP_004194640.1.102051 WP_004194640.1.10290 WP_004194640.1.10907 WP_004194640.1.11160 WP_004194640.1.11268 WP_004194640.1.11893 WP_004194640.1.12856 WP_004194640.1.13198 WP_004194640.1.13504 WP_004194640.1.13520 WP_004194640.1.13603 WP_004194640.1.13639 WP_004194640.1.13925 WP_004194640.1.14356 WP_004194640.1.14557 WP_004194640.1.1465 WP_004194640.1.15170 WP_004194640.1.15364 WP_004194640.1.15525 WP_004194640.1.16090 WP_004194640.1.16249 WP_004194640.1.16625 WP_004194640.1.16680 WP_004194640.1.16689 WP_004194640.1.17473 WP_004194640.1.17786 WP_004194640.1.18058 WP_004194640.1.18405 WP_004194640.1.18471 WP_004194640.1.18631 WP_004194640.1.18669 WP_004194640.1.18744 WP_004194640.1.18868 WP_004194640.1.18906 WP_004194640.1.19401 WP_004194640.1.19540 WP_004194640.1.19629 WP_004194640.1.1976 WP_004194640.1.19815 WP_004194640.1.19854 WP_004194640.1.20531 WP_004194640.1.20673 WP_004194640.1.21147 WP_004194640.1.21205 WP_004194640.1.21291 WP_004194640.1.21304 WP_004194640.1.21442 WP_004194640.1.21653 WP_004194640.1.21809 WP_004194640.1.22299 WP_004194640.1.22329 WP_004194640.1.22625 WP_004194640.1.22779 WP_004194640.1.23009 WP_004194640.1.2317 WP_004194640.1.24020 WP_004194640.1.2404 WP_004194640.1.24134 WP_004194640.1.24372 WP_004194640.1.24513 WP_004194640.1.2462 WP_004194640.1.24701 WP_004194640.1.25102 WP_004194640.1.25138 WP_004194640.1.25265 WP_004194640.1.25412 WP_004194640.1.25728 WP_004194640.1.26445 WP_004194640.1.26565 WP_004194640.1.26633 WP_004194640.1.26838 WP_004194640.1.27069 WP_004194640.1.27363 WP_004194640.1.27390 WP_004194640.1.27399 WP_004194640.1.27420 WP_004194640.1.2767 WP_004194640.1.27810 WP_004194640.1.28066 WP_004194640.1.28453 WP_004194640.1.28594 WP_004194640.1.28632 WP_004194640.1.29148 WP_004194640.1.29161 WP_004194640.1.29335 WP_004194640.1.29405 WP_004194640.1.29520 WP_004194640.1.29547 WP_004194640.1.29658 WP_004194640.1.29853 WP_004194640.1.29887 WP_004194640.1.29899 WP_004194640.1.29948 WP_004194640.1.30311 WP_004194640.1.3041 WP_004194640.1.3069 WP_004194640.1.30729 WP_004194640.1.31343 WP_004194640.1.31831 WP_004194640.1.32174 WP_004194640.1.32221 WP_004194640.1.324 WP_004194640.1.3251 WP_004194640.1.32581 WP_004194640.1.32951 WP_004194640.1.33087 WP_004194640.1.33157 WP_004194640.1.33165 WP_004194640.1.33419 WP_004194640.1.33493 WP_004194640.1.33543 WP_004194640.1.34230 WP_004194640.1.34333 WP_004194640.1.34747 WP_004194640.1.35474 WP_004194640.1.35757 WP_004194640.1.35878 WP_004194640.1.36106 WP_004194640.1.366 WP_004194640.1.36662 WP_004194640.1.36666 WP_004194640.1.36944 WP_004194640.1.37517 WP_004194640.1.37535 WP_004194640.1.37627 WP_004194640.1.37690 WP_004194640.1.37806 WP_004194640.1.37934 WP_004194640.1.37959 WP_004194640.1.37994 WP_004194640.1.38115 WP_004194640.1.38442 WP_004194640.1.38490 WP_004194640.1.38683 WP_004194640.1.3872 WP_004194640.1.38946 WP_004194640.1.39078 WP_004194640.1.39162 WP_004194640.1.39179 WP_004194640.1.39349 WP_004194640.1.3947 WP_004194640.1.39757 WP_004194640.1.39898 WP_004194640.1.40021 WP_004194640.1.40045 WP_004194640.1.40191 WP_004194640.1.40235 WP_004194640.1.40426 WP_004194640.1.40448 WP_004194640.1.4077 WP_004194640.1.41477 WP_004194640.1.42408 WP_004194640.1.42496 WP_004194640.1.42800 WP_004194640.1.43136 WP_004194640.1.43156 WP_004194640.1.43373 WP_004194640.1.43727 WP_004194640.1.43786 WP_004194640.1.43899 WP_004194640.1.44179 WP_004194640.1.44234 WP_004194640.1.44414 WP_004194640.1.44540 WP_004194640.1.45890 WP_004194640.1.46969 WP_004194640.1.47149 WP_004194640.1.4810 WP_004194640.1.48313 WP_004194640.1.48407 WP_004194640.1.48464 WP_004194640.1.49026 WP_004194640.1.49717 WP_004194640.1.50401 WP_004194640.1.50636 WP_004194640.1.50788 WP_004194640.1.50839 WP_004194640.1.51606 WP_004194640.1.5173 WP_004194640.1.51902 WP_004194640.1.52229 WP_004194640.1.52407 WP_004194640.1.52451 WP_004194640.1.52521 WP_004194640.1.52643 WP_004194640.1.52731 WP_004194640.1.52760 WP_004194640.1.5292 WP_004194640.1.53034 WP_004194640.1.53048 WP_004194640.1.53103 WP_004194640.1.53282 WP_004194640.1.5338 WP_004194640.1.53578 WP_004194640.1.53977 WP_004194640.1.54016 WP_004194640.1.54312 WP_004194640.1.54804 WP_004194640.1.54859 WP_004194640.1.54892 WP_004194640.1.55415 WP_004194640.1.55691 WP_004194640.1.55755 WP_004194640.1.55974 WP_004194640.1.55996 WP_004194640.1.5608 WP_004194640.1.5641 WP_004194640.1.56451 WP_004194640.1.56458 WP_004194640.1.56591 WP_004194640.1.56949 WP_004194640.1.57096 WP_004194640.1.57247 WP_004194640.1.5734 WP_004194640.1.57341 WP_004194640.1.57359 WP_004194640.1.57679 WP_004194640.1.58355 WP_004194640.1.58405 WP_004194640.1.5883 WP_004194640.1.59255 WP_004194640.1.59422 WP_004194640.1.59536 WP_004194640.1.60769 WP_004194640.1.60810 WP_004194640.1.60836 WP_004194640.1.60969 WP_004194640.1.61073 WP_004194640.1.61084 WP_004194640.1.61588 WP_004194640.1.61685 WP_004194640.1.61723 WP_004194640.1.61854 WP_004194640.1.6186 WP_004194640.1.61900 WP_004194640.1.62103 WP_004194640.1.63097 WP_004194640.1.63261 WP_004194640.1.63361 WP_004194640.1.63379 WP_004194640.1.63439 WP_004194640.1.63661 WP_004194640.1.63719 WP_004194640.1.63942 WP_004194640.1.64204 WP_004194640.1.64364 WP_004194640.1.64383 WP_004194640.1.64683 WP_004194640.1.64892 WP_004194640.1.65093 WP_004194640.1.65832 WP_004194640.1.65994 WP_004194640.1.66257 WP_004194640.1.66321 WP_004194640.1.67117 WP_004194640.1.67182 WP_004194640.1.67393 WP_004194640.1.67559 WP_004194640.1.67860 WP_004194640.1.67909 WP_004194640.1.67914 WP_004194640.1.67978 WP_004194640.1.68353 WP_004194640.1.68664 WP_004194640.1.68886 WP_004194640.1.69081 WP_004194640.1.69094 WP_004194640.1.69918 WP_004194640.1.7006 WP_004194640.1.70066 WP_004194640.1.70278 WP_004194640.1.70735 WP_004194640.1.71444 WP_004194640.1.71564 WP_004194640.1.71901 WP_004194640.1.72015 WP_004194640.1.72083 WP_004194640.1.72545 WP_004194640.1.72798 WP_004194640.1.72817 WP_004194640.1.73317 WP_004194640.1.73521 WP_004194640.1.73576 WP_004194640.1.73906 WP_004194640.1.74425 WP_004194640.1.7450 WP_004194640.1.74675 WP_004194640.1.74690 WP_004194640.1.75027 WP_004194640.1.75075 WP_004194640.1.75276 WP_004194640.1.75519 WP_004194640.1.75708 WP_004194640.1.75711 WP_004194640.1.75776 WP_004194640.1.75861 WP_004194640.1.75883 WP_004194640.1.75937 WP_004194640.1.76142 WP_004194640.1.76290 WP_004194640.1.76522 WP_004194640.1.766 WP_004194640.1.77249 WP_004194640.1.77689 WP_004194640.1.77845 WP_004194640.1.78029 WP_004194640.1.78628 WP_004194640.1.78759 WP_004194640.1.78827 WP_004194640.1.79653 WP_004194640.1.79725 WP_004194640.1.79782 WP_004194640.1.80302 WP_004194640.1.80395 WP_004194640.1.80433 WP_004194640.1.80614 WP_004194640.1.80923 WP_004194640.1.81665 WP_004194640.1.82197 WP_004194640.1.82283 WP_004194640.1.82394 WP_004194640.1.82575 WP_004194640.1.82694 WP_004194640.1.83357 WP_004194640.1.83487 WP_004194640.1.83543 WP_004194640.1.83609 WP_004194640.1.83688 WP_004194640.1.8390 WP_004194640.1.8395 WP_004194640.1.83967 WP_004194640.1.84002 WP_004194640.1.84026 WP_004194640.1.84063 WP_004194640.1.84375 WP_004194640.1.84379 WP_004194640.1.84480 WP_004194640.1.85412 WP_004194640.1.85443 WP_004194640.1.85584 WP_004194640.1.85645 WP_004194640.1.85774 WP_004194640.1.86295 WP_004194640.1.86525 WP_004194640.1.86806 WP_004194640.1.87278 WP_004194640.1.87324 WP_004194640.1.87553 WP_004194640.1.87652 WP_004194640.1.87811 WP_004194640.1.88117 WP_004194640.1.88237 WP_004194640.1.89093 WP_004194640.1.89514 WP_004194640.1.91025 WP_004194640.1.91198 WP_004194640.1.91700 WP_004194640.1.91709 WP_004194640.1.9236 WP_004194640.1.92430 WP_004194640.1.9281 WP_004194640.1.92904 WP_004194640.1.93844 WP_004194640.1.94050 WP_004194640.1.94117 WP_004194640.1.94121 WP_004194640.1.94286 WP_004194640.1.94403 WP_004194640.1.94498 WP_004194640.1.94520 WP_004194640.1.9479 WP_004194640.1.94901 WP_004194640.1.95054 WP_004194640.1.95300 WP_004194640.1.9537 WP_004194640.1.95587 WP_004194640.1.95644 WP_004194640.1.95672 WP_004194640.1.95952 WP_004194640.1.96381 WP_004194640.1.96660 WP_004194640.1.97112 WP_004194640.1.97148 WP_004194640.1.98491 WP_004194640.1.98547 WP_004194640.1.98713 WP_004194640.1.98753 WP_004194640.1.98768 WP_004194640.1.98944 WP_004194640.1.99160 WP_004194640.1.99290 WP_004194640.1.9962 WP_004194640.1.99629 WP_004194640.1.9975 YP_110364.1.59693 gi|126456762|ref|YP_001074529.1| gi|121597038|ref|YP_991350.1| NYSGRC-SEC-53721379 gi|403521756|ref|YP_006657325.1| gi|126447064|ref|YP_001078094.1| gi|526456875|ref|YP_008327369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]