SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126456775|ref|YP_001074257.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126456775|ref|YP_001074257.1|
Domain Number 1 Region: 1-271
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.66e-63
Family Phosphate binding protein-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126456775|ref|YP_001074257.1|
Sequence length 299
Comment solute-binding family 1 protein [Burkholderia pseudomallei 1106a]
Sequence
MMKPLRPLLSIAVGCALAAAAHADDAGPTLKKIRDTGVVTLGVRESSVPFSYYDQQQRTI
GYSQEIALKIVDEIKKTLNRPNLTVREIPITSQNRIPLVQNGTVDLECGSTTHTKERANQ
VSFSNSIFQYGMRLIVKKSSGVKDFPDLAGKTVATTAGTTEERLLRQWNAEKGMAMQIIS
AKDHADAFLNVKSGRAVAFFMDEPLLYGAKAKEANPGDYVITGNSPVSEAYGCMLRKDDP
GFKQLADRVIARMQRSGEAEALYVKWFNRPIPPKGVNLDYPLSADMKQLFANPNDKALD
Download sequence
Identical sequences A0A0H3HUA7 A0A1S0SK41 A3NG39 A3P1P7 C4I614
gi|126456775|ref|YP_001074257.1| gi|126444823|ref|YP_001061310.1| WP_004523579.1.100195 WP_004523579.1.10047 WP_004523579.1.100720 WP_004523579.1.1010 WP_004523579.1.101060 WP_004523579.1.101307 WP_004523579.1.101381 WP_004523579.1.101559 WP_004523579.1.101588 WP_004523579.1.101783 WP_004523579.1.102051 WP_004523579.1.10269 WP_004523579.1.10290 WP_004523579.1.10359 WP_004523579.1.10553 WP_004523579.1.10633 WP_004523579.1.10746 WP_004523579.1.1098 WP_004523579.1.11046 WP_004523579.1.11160 WP_004523579.1.11268 WP_004523579.1.11404 WP_004523579.1.11825 WP_004523579.1.11893 WP_004523579.1.11998 WP_004523579.1.12793 WP_004523579.1.12860 WP_004523579.1.13198 WP_004523579.1.13597 WP_004523579.1.14356 WP_004523579.1.14539 WP_004523579.1.14557 WP_004523579.1.1465 WP_004523579.1.14660 WP_004523579.1.15170 WP_004523579.1.15364 WP_004523579.1.15525 WP_004523579.1.15696 WP_004523579.1.16090 WP_004523579.1.16249 WP_004523579.1.16358 WP_004523579.1.16540 WP_004523579.1.16561 WP_004523579.1.16625 WP_004523579.1.16680 WP_004523579.1.16749 WP_004523579.1.17067 WP_004523579.1.17068 WP_004523579.1.17278 WP_004523579.1.17748 WP_004523579.1.18058 WP_004523579.1.18396 WP_004523579.1.18471 WP_004523579.1.18549 WP_004523579.1.18631 WP_004523579.1.18669 WP_004523579.1.18704 WP_004523579.1.18868 WP_004523579.1.19401 WP_004523579.1.19486 WP_004523579.1.19540 WP_004523579.1.19815 WP_004523579.1.19842 WP_004523579.1.19854 WP_004523579.1.20021 WP_004523579.1.20246 WP_004523579.1.20501 WP_004523579.1.20520 WP_004523579.1.20673 WP_004523579.1.20954 WP_004523579.1.21147 WP_004523579.1.21205 WP_004523579.1.21291 WP_004523579.1.21304 WP_004523579.1.21461 WP_004523579.1.21653 WP_004523579.1.21809 WP_004523579.1.22046 WP_004523579.1.22299 WP_004523579.1.22308 WP_004523579.1.2261 WP_004523579.1.23009 WP_004523579.1.23104 WP_004523579.1.23131 WP_004523579.1.2317 WP_004523579.1.23743 WP_004523579.1.23852 WP_004523579.1.23994 WP_004523579.1.24020 WP_004523579.1.2404 WP_004523579.1.24134 WP_004523579.1.24314 WP_004523579.1.24372 WP_004523579.1.24454 WP_004523579.1.24513 WP_004523579.1.2462 WP_004523579.1.24701 WP_004523579.1.25068 WP_004523579.1.25102 WP_004523579.1.25138 WP_004523579.1.25628 WP_004523579.1.25728 WP_004523579.1.259 WP_004523579.1.26054 WP_004523579.1.26502 WP_004523579.1.26535 WP_004523579.1.26565 WP_004523579.1.26633 WP_004523579.1.26645 WP_004523579.1.267 WP_004523579.1.26838 WP_004523579.1.26849 WP_004523579.1.27064 WP_004523579.1.27146 WP_004523579.1.27390 WP_004523579.1.27399 WP_004523579.1.27420 WP_004523579.1.27441 WP_004523579.1.27597 WP_004523579.1.2767 WP_004523579.1.27810 WP_004523579.1.27909 WP_004523579.1.28018 WP_004523579.1.28066 WP_004523579.1.28187 WP_004523579.1.28594 WP_004523579.1.28619 WP_004523579.1.28632 WP_004523579.1.29178 WP_004523579.1.29405 WP_004523579.1.29508 WP_004523579.1.29547 WP_004523579.1.29658 WP_004523579.1.29853 WP_004523579.1.29878 WP_004523579.1.29899 WP_004523579.1.30382 WP_004523579.1.3041 WP_004523579.1.30671 WP_004523579.1.30729 WP_004523579.1.30966 WP_004523579.1.31343 WP_004523579.1.31723 WP_004523579.1.32174 WP_004523579.1.32182 WP_004523579.1.32581 WP_004523579.1.3273 WP_004523579.1.32951 WP_004523579.1.33077 WP_004523579.1.33087 WP_004523579.1.33165 WP_004523579.1.332 WP_004523579.1.33366 WP_004523579.1.33573 WP_004523579.1.33779 WP_004523579.1.34230 WP_004523579.1.34333 WP_004523579.1.34393 WP_004523579.1.34564 WP_004523579.1.35025 WP_004523579.1.35052 WP_004523579.1.35090 WP_004523579.1.35141 WP_004523579.1.35249 WP_004523579.1.35474 WP_004523579.1.35485 WP_004523579.1.35491 WP_004523579.1.35825 WP_004523579.1.36106 WP_004523579.1.36174 WP_004523579.1.36259 WP_004523579.1.36527 WP_004523579.1.366 WP_004523579.1.36662 WP_004523579.1.36944 WP_004523579.1.3706 WP_004523579.1.37428 WP_004523579.1.37519 WP_004523579.1.37535 WP_004523579.1.37581 WP_004523579.1.37622 WP_004523579.1.37627 WP_004523579.1.37702 WP_004523579.1.37725 WP_004523579.1.37806 WP_004523579.1.37934 WP_004523579.1.37959 WP_004523579.1.37994 WP_004523579.1.38115 WP_004523579.1.3872 WP_004523579.1.38810 WP_004523579.1.39078 WP_004523579.1.39179 WP_004523579.1.3947 WP_004523579.1.39595 WP_004523579.1.40021 WP_004523579.1.40045 WP_004523579.1.40235 WP_004523579.1.40275 WP_004523579.1.40388 WP_004523579.1.40390 WP_004523579.1.40426 WP_004523579.1.40448 WP_004523579.1.4077 WP_004523579.1.41588 WP_004523579.1.42800 WP_004523579.1.43373 WP_004523579.1.43542 WP_004523579.1.43581 WP_004523579.1.43587 WP_004523579.1.43678 WP_004523579.1.43786 WP_004523579.1.44179 WP_004523579.1.44234 WP_004523579.1.44352 WP_004523579.1.44414 WP_004523579.1.45284 WP_004523579.1.45348 WP_004523579.1.45356 WP_004523579.1.45537 WP_004523579.1.45715 WP_004523579.1.45890 WP_004523579.1.4631 WP_004523579.1.4693 WP_004523579.1.47086 WP_004523579.1.4718 WP_004523579.1.47564 WP_004523579.1.48093 WP_004523579.1.48165 WP_004523579.1.49026 WP_004523579.1.49717 WP_004523579.1.49872 WP_004523579.1.50174 WP_004523579.1.50320 WP_004523579.1.50401 WP_004523579.1.50636 WP_004523579.1.50788 WP_004523579.1.50839 WP_004523579.1.5105 WP_004523579.1.51606 WP_004523579.1.51666 WP_004523579.1.51874 WP_004523579.1.51891 WP_004523579.1.51902 WP_004523579.1.52365 WP_004523579.1.52451 WP_004523579.1.52731 WP_004523579.1.52760 WP_004523579.1.52882 WP_004523579.1.5292 WP_004523579.1.53103 WP_004523579.1.53132 WP_004523579.1.5338 WP_004523579.1.53386 WP_004523579.1.53506 WP_004523579.1.53578 WP_004523579.1.5413 WP_004523579.1.54859 WP_004523579.1.55415 WP_004523579.1.55974 WP_004523579.1.55996 WP_004523579.1.5608 WP_004523579.1.56126 WP_004523579.1.56248 WP_004523579.1.5641 WP_004523579.1.56458 WP_004523579.1.56591 WP_004523579.1.56949 WP_004523579.1.5734 WP_004523579.1.57341 WP_004523579.1.57359 WP_004523579.1.58003 WP_004523579.1.58105 WP_004523579.1.58355 WP_004523579.1.58390 WP_004523579.1.58509 WP_004523579.1.58523 WP_004523579.1.58578 WP_004523579.1.58639 WP_004523579.1.58758 WP_004523579.1.59200 WP_004523579.1.59255 WP_004523579.1.59496 WP_004523579.1.59519 WP_004523579.1.59536 WP_004523579.1.59549 WP_004523579.1.59747 WP_004523579.1.60398 WP_004523579.1.60769 WP_004523579.1.60836 WP_004523579.1.60969 WP_004523579.1.61202 WP_004523579.1.61455 WP_004523579.1.61685 WP_004523579.1.61723 WP_004523579.1.61854 WP_004523579.1.6186 WP_004523579.1.61900 WP_004523579.1.62103 WP_004523579.1.62183 WP_004523579.1.63361 WP_004523579.1.63379 WP_004523579.1.63505 WP_004523579.1.63661 WP_004523579.1.63719 WP_004523579.1.63942 WP_004523579.1.64096 WP_004523579.1.64166 WP_004523579.1.64204 WP_004523579.1.64364 WP_004523579.1.64683 WP_004523579.1.64892 WP_004523579.1.65093 WP_004523579.1.65270 WP_004523579.1.65468 WP_004523579.1.66465 WP_004523579.1.67013 WP_004523579.1.67117 WP_004523579.1.67182 WP_004523579.1.67229 WP_004523579.1.67559 WP_004523579.1.67909 WP_004523579.1.67914 WP_004523579.1.67978 WP_004523579.1.6835 WP_004523579.1.68353 WP_004523579.1.68664 WP_004523579.1.68922 WP_004523579.1.69022 WP_004523579.1.69081 WP_004523579.1.69094 WP_004523579.1.69169 WP_004523579.1.69217 WP_004523579.1.69337 WP_004523579.1.69354 WP_004523579.1.69770 WP_004523579.1.69918 WP_004523579.1.70016 WP_004523579.1.7006 WP_004523579.1.70066 WP_004523579.1.70096 WP_004523579.1.70278 WP_004523579.1.70280 WP_004523579.1.70735 WP_004523579.1.71444 WP_004523579.1.71564 WP_004523579.1.73317 WP_004523579.1.73418 WP_004523579.1.73521 WP_004523579.1.73576 WP_004523579.1.73906 WP_004523579.1.73974 WP_004523579.1.74177 WP_004523579.1.7450 WP_004523579.1.74569 WP_004523579.1.74690 WP_004523579.1.75001 WP_004523579.1.75075 WP_004523579.1.75276 WP_004523579.1.75519 WP_004523579.1.75677 WP_004523579.1.75708 WP_004523579.1.75913 WP_004523579.1.75937 WP_004523579.1.76142 WP_004523579.1.76432 WP_004523579.1.76522 WP_004523579.1.76575 WP_004523579.1.766 WP_004523579.1.7703 WP_004523579.1.77249 WP_004523579.1.77287 WP_004523579.1.77319 WP_004523579.1.77788 WP_004523579.1.78029 WP_004523579.1.78278 WP_004523579.1.78506 WP_004523579.1.78628 WP_004523579.1.78759 WP_004523579.1.78807 WP_004523579.1.78827 WP_004523579.1.795 WP_004523579.1.79689 WP_004523579.1.79710 WP_004523579.1.79725 WP_004523579.1.79782 WP_004523579.1.80098 WP_004523579.1.80302 WP_004523579.1.80614 WP_004523579.1.80923 WP_004523579.1.81042 WP_004523579.1.8126 WP_004523579.1.81479 WP_004523579.1.81511 WP_004523579.1.81543 WP_004523579.1.81665 WP_004523579.1.82197 WP_004523579.1.82575 WP_004523579.1.82694 WP_004523579.1.82727 WP_004523579.1.82915 WP_004523579.1.82950 WP_004523579.1.83080 WP_004523579.1.8341 WP_004523579.1.83543 WP_004523579.1.83567 WP_004523579.1.83609 WP_004523579.1.83688 WP_004523579.1.8388 WP_004523579.1.8395 WP_004523579.1.83967 WP_004523579.1.84002 WP_004523579.1.84026 WP_004523579.1.84181 WP_004523579.1.84375 WP_004523579.1.84654 WP_004523579.1.84866 WP_004523579.1.85443 WP_004523579.1.85467 WP_004523579.1.85565 WP_004523579.1.856 WP_004523579.1.85641 WP_004523579.1.85645 WP_004523579.1.85774 WP_004523579.1.8585 WP_004523579.1.8629 WP_004523579.1.86295 WP_004523579.1.86438 WP_004523579.1.86806 WP_004523579.1.86872 WP_004523579.1.8697 WP_004523579.1.87114 WP_004523579.1.87324 WP_004523579.1.87553 WP_004523579.1.87652 WP_004523579.1.87759 WP_004523579.1.87811 WP_004523579.1.88168 WP_004523579.1.88237 WP_004523579.1.88322 WP_004523579.1.88369 WP_004523579.1.88666 WP_004523579.1.88682 WP_004523579.1.88764 WP_004523579.1.88920 WP_004523579.1.8912 WP_004523579.1.89240 WP_004523579.1.89435 WP_004523579.1.89782 WP_004523579.1.90079 WP_004523579.1.90471 WP_004523579.1.9079 WP_004523579.1.90934 WP_004523579.1.91025 WP_004523579.1.91142 WP_004523579.1.91198 WP_004523579.1.91700 WP_004523579.1.91763 WP_004523579.1.91823 WP_004523579.1.92095 WP_004523579.1.92406 WP_004523579.1.92430 WP_004523579.1.92507 WP_004523579.1.9280 WP_004523579.1.92904 WP_004523579.1.93844 WP_004523579.1.93845 WP_004523579.1.94023 WP_004523579.1.94050 WP_004523579.1.94117 WP_004523579.1.94403 WP_004523579.1.94498 WP_004523579.1.94901 WP_004523579.1.94926 WP_004523579.1.95054 WP_004523579.1.95300 WP_004523579.1.95339 WP_004523579.1.9537 WP_004523579.1.95420 WP_004523579.1.95587 WP_004523579.1.95644 WP_004523579.1.95938 WP_004523579.1.96381 WP_004523579.1.97058 WP_004523579.1.97112 WP_004523579.1.97989 WP_004523579.1.98218 WP_004523579.1.98316 WP_004523579.1.98753 WP_004523579.1.98768 WP_004523579.1.99061 WP_004523579.1.99069 WP_004523579.1.99160 WP_004523579.1.99233 WP_004523579.1.99290 WP_004523579.1.9962 WP_004523579.1.99629 WP_004523579.1.99741 WP_004523579.1.9975 WP_004523579.1.9983 gi|386863905|ref|YP_006276853.1| 320373.BURPS668_A0304 357348.BURPS1106A_A0214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]