SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126456840|ref|YP_001075705.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126456840|ref|YP_001075705.1|
Domain Number 1 Region: 18-248
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.58e-27
Family Phosphate binding protein-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126456840|ref|YP_001075705.1|
Sequence length 353
Comment putative regulatory protein [Burkholderia pseudomallei 1106a]
Sequence
MNTARIKAAAADMPERARLRIGFVALSDAAPLVAAQRLELGARYGLTLELCRQPSWASIR
DKLLSGELDAAHALYGLVYGVQLGIGGPRADLAVPMVLNRNGQAITFSNRLADAYRASGE
LKAALATLGRRPVFAQTFPTGTHAMWLYHWLASHGVDPLHDVRSVVIPPPEMVDALAAGE
LDGLCVGEPWNAVAEARGAGRTVAATSEVWPDHPEKALACRREFVALYPNTARLLVRTLL
DACEWLDDADHRMKAAAWLAEPDAIGVPIGQIAPRLLGDYGAGPFAQPPAPIKFYEHGTV
NRPAASDGMWFLSQYRRWGMLSGDVDDAAIANGVAHTALYDEAVALGGARRGE
Download sequence
Identical sequences A0A095REI1 A0A0E1S7N4 A3P5U5
WP_004537364.1.101060 WP_004537364.1.101307 WP_004537364.1.10907 WP_004537364.1.1098 WP_004537364.1.11998 WP_004537364.1.1266 WP_004537364.1.12856 WP_004537364.1.13520 WP_004537364.1.13639 WP_004537364.1.15673 WP_004537364.1.16249 WP_004537364.1.16689 WP_004537364.1.22779 WP_004537364.1.23009 WP_004537364.1.23994 WP_004537364.1.25265 WP_004537364.1.27069 WP_004537364.1.28066 WP_004537364.1.28187 WP_004537364.1.29335 WP_004537364.1.29520 WP_004537364.1.29853 WP_004537364.1.29887 WP_004537364.1.30382 WP_004537364.1.3069 WP_004537364.1.30966 WP_004537364.1.33157 WP_004537364.1.38490 WP_004537364.1.3872 WP_004537364.1.39162 WP_004537364.1.39179 WP_004537364.1.39757 WP_004537364.1.41945 WP_004537364.1.42408 WP_004537364.1.42496 WP_004537364.1.43136 WP_004537364.1.43786 WP_004537364.1.46757 WP_004537364.1.48464 WP_004537364.1.50839 WP_004537364.1.5182 WP_004537364.1.52229 WP_004537364.1.52407 WP_004537364.1.52547 WP_004537364.1.52643 WP_004537364.1.53048 WP_004537364.1.54016 WP_004537364.1.54312 WP_004537364.1.54859 WP_004537364.1.55038 WP_004537364.1.55691 WP_004537364.1.55755 WP_004537364.1.5608 WP_004537364.1.56744 WP_004537364.1.57046 WP_004537364.1.57247 WP_004537364.1.58003 WP_004537364.1.58390 WP_004537364.1.59422 WP_004537364.1.59536 WP_004537364.1.60810 WP_004537364.1.61084 WP_004537364.1.61685 WP_004537364.1.63439 WP_004537364.1.64068 WP_004537364.1.64383 WP_004537364.1.66321 WP_004537364.1.66465 WP_004537364.1.67860 WP_004537364.1.68886 WP_004537364.1.69354 WP_004537364.1.70278 WP_004537364.1.71901 WP_004537364.1.72817 WP_004537364.1.73521 WP_004537364.1.74425 WP_004537364.1.75027 WP_004537364.1.75711 WP_004537364.1.76142 WP_004537364.1.766 WP_004537364.1.77689 WP_004537364.1.79360 WP_004537364.1.80433 WP_004537364.1.82506 WP_004537364.1.83357 WP_004537364.1.83543 WP_004537364.1.83688 WP_004537364.1.8390 WP_004537364.1.84026 WP_004537364.1.84375 WP_004537364.1.85412 WP_004537364.1.85443 WP_004537364.1.87278 WP_004537364.1.87553 WP_004537364.1.88237 WP_004537364.1.89093 WP_004537364.1.90934 WP_004537364.1.91025 WP_004537364.1.91709 WP_004537364.1.92493 WP_004537364.1.97148 WP_004537364.1.98547 WP_004537364.1.98713 WP_004537364.1.98768 WP_004537364.1.9962 gi|126456840|ref|YP_001075705.1| gi|526458260|ref|YP_008328317.1| 357348.BURPS1106A_A1672 gi|403522943|ref|YP_006658512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]