SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126456852|ref|YP_001074164.1| from Burkholderia pseudomallei 1106a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126456852|ref|YP_001074164.1|
Domain Number 1 Region: 279-537
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000785
Family Tropomyosin 0.0019
Further Details:      
 
Domain Number 2 Region: 54-289
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000414
Family Tropomyosin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126456852|ref|YP_001074164.1|
Sequence length 746
Comment hypothetical protein BURPS1106A_A0121 [Burkholderia pseudomallei 1106a]
Sequence
MSRFFSRHGLRRALRKHSTLDRVRRVLKWGRDRTHRVRKAPHWVTVRRRRAVIARQRAKA
RMRRVVTARQRVRMLTRRAHRARRRAKVRKRRVATARQRGRMPPRRVHRARRRAKVRKRR
AATARQRGRMLTRRVNRARRRAKARKRRAATARQRARMPLRRVHRARRRAKVRKRRAATA
RQRGRMLTRRVNRARRQAKVRKRRAATARQRGRMLPRRVNRARRQAKARKRRVATARQRG
RMLTRRVNRARRRAKAHKRRAATARQRARMPPRRAHRARRRAKARKRRAATARQRGRMLT
RRVNRARQRAKVRKRRVATARQRGRMLSRRVNRARRRAKAHKRRGTTARQRGRMLTRRVN
RARQRAKVRKRRVATARQRGRMLTRRVNRARRRAKVRKRRVATARQRVKMLSRRVNRARR
QAKARKRPGITARQRVKMLSRRVNRARRRAKVRKRRVATARQRVRMPSRRVNRARRWAKA
RKRRAATARQRVRMLTRRVNRARRRAKVRKRRVATARQRGRMLSRRVNRARRQAKTRKRP
GITARQRVRMPPRRAHQARRRAKVRKRRAATARQRARMPPRRVNRARRRAKARKRRAATA
RRTAPVPPRPDTRALLWARALKPLVHRASRAAGTQTRRGLKASQSAAMPRRRAIKASRSE
PMRRRRATTASRWAPARRQRARTRSRWARGRSRTATTRFRWVRMAVSATSPMWRMDGTIP
TPSISGNCARSRATHTAASPPQLRWP
Download sequence
Identical sequences A3P1F4
gi|126456852|ref|YP_001074164.1| 357348.BURPS1106A_A0121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]